BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0214.Seq (429 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC839.05c |rps1701|rps17-1|40S ribosomal protein S17|Schizosac... 101 6e-23 SPCC24B10.09 |rps1702|rps17-2, rps17|40S ribosomal protein S17|S... 101 6e-23 SPAC1039.04 |||nicotinic acid plasma membrane transporter |Schiz... 27 1.2 SPCC162.08c |nup211||nuclear pore complex associated protein|Sch... 27 1.6 SPCC1827.04 |||ankyrin repeat protein, unknown biological role|S... 26 2.9 SPAC1B3.09c |||Noc2p-Noc3p complex subunit Noc2 family |Schizosa... 25 3.8 SPCC1442.06 |||20S proteasome component alpha 2|Schizosaccharomy... 25 6.6 SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyce... 24 8.7 >SPBC839.05c |rps1701|rps17-1|40S ribosomal protein S17|Schizosaccharomyces pombe|chr 2|||Manual Length = 131 Score = 101 bits (241), Expect = 6e-23 Identities = 47/64 (73%), Positives = 54/64 (84%) Frame = +3 Query: 63 IEKYYTRLTLDFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEE 242 IEKYY RLTLDF TNKRI +E+AII +K LRNKIAG+ THLM+R++ VRGIS KLQEE Sbjct: 17 IEKYYPRLTLDFQTNKRIVDEVAIIASKRLRNKIAGYTTHLMKRIQRGPVRGISFKLQEE 76 Query: 243 ERER 254 ERER Sbjct: 77 ERER 80 Score = 47.2 bits (107), Expect = 1e-06 Identities = 25/51 (49%), Positives = 33/51 (64%) Frame = +2 Query: 257 DNYVPEVSALEHDIIEVDPDTKDMLKMLDFNNINGLQLTQPATQGGYGGRR 409 D YVPEVS LE D + VD DTKDMLK L ++ I +++ PA Q + R+ Sbjct: 82 DQYVPEVSELEVDRVNVDQDTKDMLKSLGYDQI-PVRVLAPAPQERFRRRQ 131 >SPCC24B10.09 |rps1702|rps17-2, rps17|40S ribosomal protein S17|Schizosaccharomyces pombe|chr 3|||Manual Length = 132 Score = 101 bits (241), Expect = 6e-23 Identities = 47/64 (73%), Positives = 54/64 (84%) Frame = +3 Query: 63 IEKYYTRLTLDFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEE 242 IEKYY RLTLDF TNKRI +E+AII +K LRNKIAG+ THLM+R++ VRGIS KLQEE Sbjct: 17 IEKYYPRLTLDFQTNKRIVDEVAIIASKRLRNKIAGYTTHLMKRIQRGPVRGISFKLQEE 76 Query: 243 ERER 254 ERER Sbjct: 77 ERER 80 Score = 47.2 bits (107), Expect = 1e-06 Identities = 22/33 (66%), Positives = 25/33 (75%) Frame = +2 Query: 257 DNYVPEVSALEHDIIEVDPDTKDMLKMLDFNNI 355 D YVPEVS LE D I VD DTKDMLK L +++I Sbjct: 82 DQYVPEVSELEKDKINVDQDTKDMLKALGYDSI 114 >SPAC1039.04 |||nicotinic acid plasma membrane transporter |Schizosaccharomyces pombe|chr 1|||Manual Length = 507 Score = 27.1 bits (57), Expect = 1.2 Identities = 12/37 (32%), Positives = 24/37 (64%) Frame = -3 Query: 151 RGLVGMIAISSHILLFVSKSSVNLV*YFSIIIFAAFL 41 RG+V + AIS+ ++ F+ S++++ + + FA FL Sbjct: 352 RGIVLIAAISTTMIGFIVYGSIDIMNHIGVSYFACFL 388 >SPCC162.08c |nup211||nuclear pore complex associated protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 1837 Score = 26.6 bits (56), Expect = 1.6 Identities = 19/66 (28%), Positives = 33/66 (50%) Frame = +3 Query: 99 DTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEEERERVTTMSQKC 278 D K + ++I II K L++ +A +TH + L+H+Q S++ E + T Sbjct: 145 DKEKEVEKKITII--KDLKDALAS-STHQVLELQHTQQEKASLQTNYEFELQKLTQKNSI 201 Query: 279 LLSNMT 296 L +N T Sbjct: 202 LENNNT 207 >SPCC1827.04 |||ankyrin repeat protein, unknown biological role|Schizosaccharomyces pombe|chr 3|||Manual Length = 600 Score = 25.8 bits (54), Expect = 2.9 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = +3 Query: 204 SQVRGISIKLQEEERERVTTMSQKCLLSNM 293 S V ISIK QEEER+R + ++ S + Sbjct: 351 SHVDSISIKAQEEERKRQAEIEKEIRQSRL 380 >SPAC1B3.09c |||Noc2p-Noc3p complex subunit Noc2 family |Schizosaccharomyces pombe|chr 1|||Manual Length = 528 Score = 25.4 bits (53), Expect = 3.8 Identities = 12/25 (48%), Positives = 15/25 (60%) Frame = -3 Query: 169 PAILFLRGLVGMIAISSHILLFVSK 95 P I LRGLV A H+L F++K Sbjct: 457 PIIAQLRGLVNESAPGKHVLTFLNK 481 >SPCC1442.06 |||20S proteasome component alpha 2|Schizosaccharomyces pombe|chr 3|||Manual Length = 245 Score = 24.6 bits (51), Expect = 6.6 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +3 Query: 123 EIAIIPTKPLRNKIAGFATHLMRRLRHSQVR 215 EIA++ TKP + I G RL S++R Sbjct: 209 EIAVVSTKPTDSGIVGVPGGHFCRLSQSEIR 239 >SPAC19G12.07c |rsd1||RNA-binding protein Rsd1|Schizosaccharomyces pombe|chr 1|||Manual Length = 604 Score = 24.2 bits (50), Expect = 8.7 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 189 RRLRHSQVRGISIKLQEEERERVTTMSQKCLLSNMTS 299 R+ S+ R S KL EEER+R T + L + +TS Sbjct: 218 RKRSRSRPRERSSKLSEEERDRRTVFVSQ-LANRLTS 253 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,660,410 Number of Sequences: 5004 Number of extensions: 30894 Number of successful extensions: 90 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 87 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 154448264 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -