BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0214.Seq (429 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g04800.2 68418.m00499 40S ribosomal protein S17 (RPS17D) 40S ... 105 1e-23 At5g04800.1 68418.m00498 40S ribosomal protein S17 (RPS17D) 40S ... 105 1e-23 At3g10610.1 68416.m01276 40S ribosomal protein S17 (RPS17C) simi... 105 1e-23 At2g05220.1 68415.m00550 40S ribosomal protein S17 (RPS17B) 105 1e-23 At2g04390.1 68415.m00442 40S ribosomal protein S17 (RPS17A) 105 1e-23 At5g40530.2 68418.m04918 expressed protein contains Pfam profile... 29 1.8 At5g40530.1 68418.m04919 expressed protein contains Pfam profile... 29 1.8 At2g46020.2 68415.m05725 transcription regulatory protein SNF2, ... 27 5.4 At2g46020.1 68415.m05724 transcription regulatory protein SNF2, ... 27 5.4 At3g24495.1 68416.m03072 DNA mismatch repair protein MSH6-2 (MSH... 27 7.1 At5g43300.1 68418.m05292 glycerophosphoryl diester phosphodieste... 26 9.4 >At5g04800.2 68418.m00499 40S ribosomal protein S17 (RPS17D) 40S ribosomal protein S17, Lycopersicon esculentum, EMBL:AF161704 Length = 141 Score = 105 bits (253), Expect = 1e-23 Identities = 48/64 (75%), Positives = 58/64 (90%) Frame = +3 Query: 63 IEKYYTRLTLDFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEE 242 IEKYY+R+TLDF TNK+I EE+AIIP+K LRNKIAGF+THLM+R++ VRGIS+KLQEE Sbjct: 17 IEKYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEE 76 Query: 243 ERER 254 ERER Sbjct: 77 ERER 80 >At5g04800.1 68418.m00498 40S ribosomal protein S17 (RPS17D) 40S ribosomal protein S17, Lycopersicon esculentum, EMBL:AF161704 Length = 141 Score = 105 bits (253), Expect = 1e-23 Identities = 48/64 (75%), Positives = 58/64 (90%) Frame = +3 Query: 63 IEKYYTRLTLDFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEE 242 IEKYY+R+TLDF TNK+I EE+AIIP+K LRNKIAGF+THLM+R++ VRGIS+KLQEE Sbjct: 17 IEKYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEE 76 Query: 243 ERER 254 ERER Sbjct: 77 ERER 80 >At3g10610.1 68416.m01276 40S ribosomal protein S17 (RPS17C) similar to 40S ribosomal protein S17 GB:AAD50774 [Lycopersicon esculentum] Length = 140 Score = 105 bits (253), Expect = 1e-23 Identities = 48/64 (75%), Positives = 58/64 (90%) Frame = +3 Query: 63 IEKYYTRLTLDFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEE 242 IEKYY+R+TLDF TNK+I EE+AIIP+K LRNKIAGF+THLM+R++ VRGIS+KLQEE Sbjct: 17 IEKYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEE 76 Query: 243 ERER 254 ERER Sbjct: 77 ERER 80 >At2g05220.1 68415.m00550 40S ribosomal protein S17 (RPS17B) Length = 140 Score = 105 bits (253), Expect = 1e-23 Identities = 48/64 (75%), Positives = 58/64 (90%) Frame = +3 Query: 63 IEKYYTRLTLDFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEE 242 IEKYY+R+TLDF TNK+I EE+AIIP+K LRNKIAGF+THLM+R++ VRGIS+KLQEE Sbjct: 17 IEKYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEE 76 Query: 243 ERER 254 ERER Sbjct: 77 ERER 80 >At2g04390.1 68415.m00442 40S ribosomal protein S17 (RPS17A) Length = 141 Score = 105 bits (253), Expect = 1e-23 Identities = 48/64 (75%), Positives = 58/64 (90%) Frame = +3 Query: 63 IEKYYTRLTLDFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVRGISIKLQEE 242 IEKYY+R+TLDF TNK+I EE+AIIP+K LRNKIAGF+THLM+R++ VRGIS+KLQEE Sbjct: 17 IEKYYSRMTLDFHTNKKILEEVAIIPSKRLRNKIAGFSTHLMKRIQKGPVRGISLKLQEE 76 Query: 243 ERER 254 ERER Sbjct: 77 ERER 80 >At5g40530.2 68418.m04918 expressed protein contains Pfam profile PF05148: Protein of unknown function (DUF691) Length = 301 Score = 28.7 bits (61), Expect = 1.8 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -1 Query: 378 GCVSCRPLILLKSSIFNISLVSGSTSMMSCSRADTS 271 GC R +K+ +F+ LVS + S+++C ++TS Sbjct: 142 GCGDARIAKSVKNKVFSFDLVSKNPSVIACDMSNTS 177 >At5g40530.1 68418.m04919 expressed protein contains Pfam profile PF05148: Protein of unknown function (DUF691) Length = 287 Score = 28.7 bits (61), Expect = 1.8 Identities = 12/36 (33%), Positives = 22/36 (61%) Frame = -1 Query: 378 GCVSCRPLILLKSSIFNISLVSGSTSMMSCSRADTS 271 GC R +K+ +F+ LVS + S+++C ++TS Sbjct: 142 GCGDARIAKSVKNKVFSFDLVSKNPSVIACDMSNTS 177 >At2g46020.2 68415.m05725 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2193 Score = 27.1 bits (57), Expect = 5.4 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +3 Query: 84 LTLDFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVR-GISIKLQEEERE 251 LTL +D ICEE A +K + + L + L ++R + ++LQ EE++ Sbjct: 679 LTLAYDIKDLICEEGAEFLSKKRTDSLKKINGLLAKNLERKRIRPDLVLRLQIEEKK 735 >At2g46020.1 68415.m05724 transcription regulatory protein SNF2, putative similar to SP|P22082 Transcription regulatory protein SNF2 (SWI/SNF complex component SNF2) {Saccharomyces cerevisiae}; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain Length = 2192 Score = 27.1 bits (57), Expect = 5.4 Identities = 17/57 (29%), Positives = 29/57 (50%), Gaps = 1/57 (1%) Frame = +3 Query: 84 LTLDFDTNKRICEEIAIIPTKPLRNKIAGFATHLMRRLRHSQVR-GISIKLQEEERE 251 LTL +D ICEE A +K + + L + L ++R + ++LQ EE++ Sbjct: 679 LTLAYDIKDLICEEGAEFLSKKRTDSLKKINGLLAKNLERKRIRPDLVLRLQIEEKK 735 >At3g24495.1 68416.m03072 DNA mismatch repair protein MSH6-2 (MSH7) identical to SP|Q9SMV7 DNA mismatch repair protein MSH6-2 (AtMsh6-2) (MutS homolog 7) {Arabidopsis thaliana}; GC donor splice site at exon 11 Length = 1109 Score = 26.6 bits (56), Expect = 7.1 Identities = 14/31 (45%), Positives = 20/31 (64%) Frame = +1 Query: 76 IQD*HLILIQIKEYVKKSLSFLPSLLGIKLL 168 + D +L +IK V+ S S LP+LLG K+L Sbjct: 635 LPDLERLLGRIKSSVRSSASVLPALLGKKVL 665 >At5g43300.1 68418.m05292 glycerophosphoryl diester phosphodiesterase family protein contains Pfam profile PF03009: Glycerophosphoryl diester phosphodiesterase family Length = 333 Score = 26.2 bits (55), Expect = 9.4 Identities = 17/38 (44%), Positives = 23/38 (60%), Gaps = 1/38 (2%) Frame = -3 Query: 364 QAINIVEVQHLQHILGV-GVYFDDVMFESRHFWDIVVT 254 Q N+VEV +LQ+++GV GV D V S +I VT Sbjct: 254 QLNNVVEVIYLQYLMGVEGVIVDMVKDISEAIANIEVT 291 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,536,049 Number of Sequences: 28952 Number of extensions: 156795 Number of successful extensions: 455 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 448 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 455 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 675111616 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -