BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0213.Seq (439 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_16055| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.42 SB_5196| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.3 SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) 27 5.1 SB_15801| Best HMM Match : eRF1_2 (HMM E-Value=4.8) 27 6.8 SB_6424| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.8 >SB_16055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 848 Score = 31.1 bits (67), Expect = 0.42 Identities = 18/48 (37%), Positives = 23/48 (47%) Frame = -1 Query: 313 QA*TDFYTSLVKEKYAFASKHIRYSLPSP*EYRCLIQLNTTWSIPCSV 170 Q+ +Y VKEK H+ + P RC I+LN WS PC V Sbjct: 738 QSQKSYYDCWVKEKIFKKGDHVLWFDKKPRRGRC-IKLNRPWSGPCIV 784 >SB_5196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 412 Score = 29.5 bits (63), Expect = 1.3 Identities = 18/42 (42%), Positives = 22/42 (52%), Gaps = 1/42 (2%) Frame = -1 Query: 439 APIPPQ-ARPGQAQPLQAVLLPRAVQVHRTLPPLRLVFPGVI 317 A PP +RP A P LP+ V R LP L VFPG++ Sbjct: 314 ATAPPSISRPATAPPPVFRGLPQLPPVFRCLPQLPPVFPGLL 355 >SB_38456| Best HMM Match : BTB (HMM E-Value=8.8e-26) Length = 1410 Score = 27.5 bits (58), Expect = 5.1 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +3 Query: 198 FSCIKHRYSYGDGKEYRICFEAKAYFSLT 284 F+ + H +SY KE ICFE L+ Sbjct: 709 FTSVDHTWSYRTSKEDSICFEVNTEIELS 737 >SB_15801| Best HMM Match : eRF1_2 (HMM E-Value=4.8) Length = 562 Score = 27.1 bits (57), Expect = 6.8 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +3 Query: 210 KHRYSYGDGKEYRICFEAKAYFSLTRLV 293 +H +S GD ++ IC +KAY L R V Sbjct: 432 EHEFSLGDAEKEFICATSKAYEELIRNV 459 >SB_6424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 27.1 bits (57), Expect = 6.8 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = -1 Query: 436 PIPPQARPGQAQPLQAVLLPRAVQVHRTLPPLRL 335 P P RPGQAQ L L +HR+L PL L Sbjct: 40 PGPMARRPGQAQTLGT--LVEDAHMHRSLRPLAL 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,056,720 Number of Sequences: 59808 Number of extensions: 229463 Number of successful extensions: 386 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 367 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 384 length of database: 16,821,457 effective HSP length: 76 effective length of database: 12,276,049 effective search space used: 847047381 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -