BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0211.Seq (568 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.) 128 2e-30 SB_59481| Best HMM Match : Exc (HMM E-Value=5.1) 29 2.6 SB_4239| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_48477| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_11111| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_34| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.5 SB_43320| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 4.6 SB_257| Best HMM Match : Tetraspannin (HMM E-Value=1.5) 28 4.6 SB_58993| Best HMM Match : EGF_CA (HMM E-Value=0) 28 6.1 SB_31307| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_25672| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 6.1 SB_31569| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.1 SB_53370| Best HMM Match : GnRH (HMM E-Value=7.1) 27 8.1 >SB_53271| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 687 Score = 128 bits (310), Expect = 2e-30 Identities = 78/178 (43%), Positives = 102/178 (57%), Gaps = 4/178 (2%) Frame = -3 Query: 566 AGFMDVVSIEKTND-CXV*SRC*GRFTIHRITPERLSTSCVKSSVCD---RT*ECSVLGN 399 AGFMDVV+I+KT + + GRF +HRIT E + D + V + Sbjct: 508 AGFMDVVTIDKTGENFRLLYDVKGRFAVHRITAEEAKYKLGRVRRVDVGAKGVPYIVTHD 567 Query: 398 A*WPHHPLPRPTYQSQRFHPVRHRNYEDYGLHQV*VWELVYDHGRP*LGRVGTIVSRERH 219 A +P P ++ DY +V GR +GRVG + RE+H Sbjct: 568 ARTIRYPDPNIKVNDTVVIDIKTGKVIDYIKFDTGNMAMVVG-GRN-MGRVGMVTHREKH 625 Query: 218 PGSFDIVHIKDSTGHTFATRLNNVFIIGKGTKAYISLPRGKGIRLTIAEERDKRIAAK 45 GSFDIVH+KD+TGH FATRL N+F+IGKG K Y+SLP+GKG+RL+IAEERD+RIA K Sbjct: 626 AGSFDIVHVKDATGHQFATRLTNIFVIGKGNKPYVSLPKGKGVRLSIAEERDRRIAEK 683 Score = 95.1 bits (226), Expect = 4e-20 Identities = 38/59 (64%), Positives = 50/59 (84%) Frame = -1 Query: 427 GPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIATTKIMDFIKFESGNLCMITGGRNLG 251 G K VPY+VTHD RTIRYPDP IKVND++ +DI T K++D+IKF++GN+ M+ GGRN+G Sbjct: 556 GAKGVPYIVTHDARTIRYPDPNIKVNDTVVIDIKTGKVIDYIKFDTGNMAMVVGGRNMG 614 >SB_59481| Best HMM Match : Exc (HMM E-Value=5.1) Length = 265 Score = 29.1 bits (62), Expect = 2.6 Identities = 21/49 (42%), Positives = 22/49 (44%), Gaps = 5/49 (10%) Frame = -3 Query: 566 AGFMDVVSIEKTNDCXV*S-----RC*GRFTIHRITPERLSTSCVKSSV 435 A D IEK N C V RC GRFT R S CVKS+V Sbjct: 77 AAATDRQGIEKWNICVVVKTPSNRRCVGRFTFLHEMKRRHSDDCVKSTV 125 >SB_4239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 228 Score = 28.7 bits (61), Expect = 3.5 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -2 Query: 156 EQRVHNRQGHEGVHLAAARQGHPPHHRRGAG 64 +Q H+ G+ H GH HHRR +G Sbjct: 41 DQSAHHDSGYYSSHQNDYHHGHKRHHRRSSG 71 >SB_48477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 592 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -3 Query: 155 NNVFIIGKGT--KAYISLPRGKGIRLTIAEERDKRIAAKV 42 N + I G T + LPR +G+ TIA+E D+R A + Sbjct: 370 NGIIITGMDTIHQNVTDLPRFQGVSFTIAKETDERTAKDI 409 >SB_11111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1252 Score = 28.7 bits (61), Expect = 3.5 Identities = 15/40 (37%), Positives = 22/40 (55%), Gaps = 2/40 (5%) Frame = -3 Query: 155 NNVFIIGKGT--KAYISLPRGKGIRLTIAEERDKRIAAKV 42 N + I G T + LPR +G+ TIA+E D+R A + Sbjct: 506 NGIIITGMDTIHQNVADLPRFQGVSFTIAKETDERTAKDI 545 >SB_34| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 28.7 bits (61), Expect = 3.5 Identities = 17/59 (28%), Positives = 24/59 (40%), Gaps = 1/59 (1%) Frame = -2 Query: 249 CGH-HRVPRETSRLLRHCAHQGLHGTHLRHEVEQRVHNRQGHEGVHLAAARQGHPPHHR 76 C H H + + + H +H LH TH+ E + R G G R PH+R Sbjct: 18 CSHTHTLSNQGHTHVLHSSHNSLHNTHMEEEGCRGGMGRVGRRG--RKGHRNHKEPHNR 74 >SB_43320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 259 Score = 28.3 bits (60), Expect = 4.6 Identities = 15/38 (39%), Positives = 19/38 (50%), Gaps = 5/38 (13%) Frame = -2 Query: 150 RVHNRQG-----HEGVHLAAARQGHPPHHRRGAGQAHR 52 +VHN +G EGV +R GH H RG+ HR Sbjct: 197 QVHNERGSPSTQREGVTKYTSRGGHQVHTERGSPSTHR 234 >SB_257| Best HMM Match : Tetraspannin (HMM E-Value=1.5) Length = 237 Score = 28.3 bits (60), Expect = 4.6 Identities = 18/57 (31%), Positives = 23/57 (40%) Frame = -2 Query: 243 HHRVPRETSRLLRHCAHQGLHGTHLRHEVEQRVHNRQGHEGVHLAAARQGHPPHHRR 73 HH P +LRH H+ + H RH H+R H H H P+H R Sbjct: 175 HHHHPSTIIIILRH-RHRQHYNRHRRHHH----HHRHRHHHHHPNHPYSHHYPNHHR 226 >SB_58993| Best HMM Match : EGF_CA (HMM E-Value=0) Length = 541 Score = 27.9 bits (59), Expect = 6.1 Identities = 11/29 (37%), Positives = 16/29 (55%) Frame = -1 Query: 280 CMITGGRNLGVWAPSCPARDIPAPSTLCT 194 C T G+ G+ CPA+D A + LC+ Sbjct: 422 CCCTAGKAWGISCELCPAKDTRAYNELCS 450 >SB_31307| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 359 Score = 27.9 bits (59), Expect = 6.1 Identities = 14/43 (32%), Positives = 21/43 (48%) Frame = -2 Query: 177 THLRHEVEQRVHNRQGHEGVHLAAARQGHPPHHRRGAGQAHRS 49 THL E + + R+ G +AAA + P + R G +RS Sbjct: 231 THLPEEKPKEISPRRAKGGAGMAAANKRQQPSNTRVIGAPYRS 273 >SB_25672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 249 Score = 27.9 bits (59), Expect = 6.1 Identities = 16/54 (29%), Positives = 26/54 (48%) Frame = +1 Query: 55 MRLSRSSAMVRRMPLPRGSEMYAFVPLPIMNTLFNLVAKVCPVESLMCTMSKEP 216 + LSR + R+P P ++ +P P T + + +CPV + TMS P Sbjct: 48 LSLSRFPCPLSRIPCP-----FSRIPCPFSRTPYTVFIILCPVSFIPYTMSLFP 96 >SB_31569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 27.5 bits (58), Expect = 8.1 Identities = 12/33 (36%), Positives = 18/33 (54%) Frame = -1 Query: 490 QSTVSPLRG*VQVV*SQACATGPKNVPYLVTHD 392 Q+ + PL + + + A G N+PYL THD Sbjct: 7 QTDLLPLMQCIWITENSIVAAGHNNMPYLFTHD 39 >SB_53370| Best HMM Match : GnRH (HMM E-Value=7.1) Length = 244 Score = 27.5 bits (58), Expect = 8.1 Identities = 13/44 (29%), Positives = 18/44 (40%), Gaps = 1/44 (2%) Frame = -2 Query: 207 RHCAHQGLHGTHLRHEVE-QRVHNRQGHEGVHLAAARQGHPPHH 79 +H H+ HGTH +H V + H + V H HH Sbjct: 137 QHVTHKEEHGTHRQHHVTYEEEHGTHRQQHVTYEEEHGTHRQHH 180 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,232,846 Number of Sequences: 59808 Number of extensions: 450420 Number of successful extensions: 1495 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1313 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1487 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1337207630 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -