BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0211.Seq (568 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 25 0.53 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 24 0.93 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 24 0.93 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 24 1.2 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 23 1.6 DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein pr... 22 3.7 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 22 4.9 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 4.9 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 21 8.6 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 25.0 bits (52), Expect = 0.53 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = -1 Query: 226 RDIPAPSTLCTSRTPRDTPSP 164 RD+P ST T+ RDT +P Sbjct: 137 RDLPGKSTTTTAEVKRDTINP 157 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 24.2 bits (50), Expect = 0.93 Identities = 11/44 (25%), Positives = 16/44 (36%) Frame = -2 Query: 195 HQGLHGTHLRHEVEQRVHNRQGHEGVHLAAARQGHPPHHRRGAG 64 H G G + H H+R G + + R P G+G Sbjct: 1755 HSGTMGPPVGHPTNASAHSRSGSQSMPRQNGRYSRVPSQGGGSG 1798 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 24.2 bits (50), Expect = 0.93 Identities = 14/43 (32%), Positives = 18/43 (41%), Gaps = 4/43 (9%) Frame = -2 Query: 195 HQGLHGT-HLRHEVEQRVHNRQGHEGVHL---AAARQGHPPHH 79 H +H T H H H++ H AA + GH PHH Sbjct: 423 HSHIHATPHHHHSHAATPHHQHSTPLAHSSYPAAIQIGHTPHH 465 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 23.8 bits (49), Expect = 1.2 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -1 Query: 226 RDIPAPSTLCTSRTPRDTPSP 164 RD+P ST T RDT +P Sbjct: 137 RDLPGKSTTTTVEVKRDTINP 157 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 23.4 bits (48), Expect = 1.6 Identities = 13/45 (28%), Positives = 21/45 (46%) Frame = -2 Query: 171 LRHEVEQRVHNRQGHEGVHLAAARQGHPPHHRRGAGQAHRSQGRR 37 ++ E QR H+ Q H + A Q H +++ Q R Q R+ Sbjct: 133 IKQETLQRHHHLQNHHHHLQSTAVQDHHRPYQQQQQQQQRQQQRQ 177 >DQ011228-1|AAY63897.1| 486|Apis mellifera Amt-2-like protein protein. Length = 486 Score = 22.2 bits (45), Expect = 3.7 Identities = 9/16 (56%), Positives = 10/16 (62%) Frame = +3 Query: 192 DVHNVEGAGMSLAGHD 239 DVH V GAG + HD Sbjct: 110 DVHGVIGAGHWIGDHD 125 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = -3 Query: 215 GSFDIVHIKDSTGHTFATRLNNVFIIGKGTKAYISLPR 102 G F VH+ T F T + + + + YI L R Sbjct: 271 GDFQPVHVHKQTAIAFRTPTYRMQQVEQPVQVYIQLKR 308 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.8 bits (44), Expect = 4.9 Identities = 11/38 (28%), Positives = 16/38 (42%) Frame = -3 Query: 215 GSFDIVHIKDSTGHTFATRLNNVFIIGKGTKAYISLPR 102 G F VH+ T F T + + + + YI L R Sbjct: 271 GDFQPVHVHKQTAIAFRTPTYRMQQVEQPVQVYIQLKR 308 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 21.0 bits (42), Expect = 8.6 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = -1 Query: 373 PDPLIKVNDSIQLDIATTKIMDFIKFESGNLCMITGGRNLG 251 PD L + LD+ +I +F NL +TG R +G Sbjct: 447 PDALRDLALLKTLDLGENRISNFYNGSFRNLDQLTGLRLIG 487 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 166,973 Number of Sequences: 438 Number of extensions: 3991 Number of successful extensions: 13 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 12 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 16440594 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -