BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0209.Seq (548 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AL157766-1|CAI13922.2| 4432|Homo sapiens spastic ataxia of Charl... 31 2.7 AF193556-1|AAF31262.1| 3829|Homo sapiens sacsin protein. 31 2.7 AB018273-1|BAA34450.1| 1004|Homo sapiens KIAA0730 protein protein. 31 2.7 >AL157766-1|CAI13922.2| 4432|Homo sapiens spastic ataxia of Charlevoix-Saguenay (sacsin) protein. Length = 4432 Score = 31.1 bits (67), Expect = 2.7 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 5/62 (8%) Frame = +1 Query: 280 NFRNSFSATESEMENSRDPILYLGLESST*VKTSALL-----RSKSQILGNTAVKVAAPY 444 + +N S++EN RD LYL + VK+S L+ KS+I GN V++ Sbjct: 3740 SLQNDSVKVRSDLENVRDLALYLPSQDGRLVKSSILVFDDAPHYKSRIQGNIGVQMLVDL 3799 Query: 445 SQ 450 SQ Sbjct: 3800 SQ 3801 >AF193556-1|AAF31262.1| 3829|Homo sapiens sacsin protein. Length = 3829 Score = 31.1 bits (67), Expect = 2.7 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 5/62 (8%) Frame = +1 Query: 280 NFRNSFSATESEMENSRDPILYLGLESST*VKTSALL-----RSKSQILGNTAVKVAAPY 444 + +N S++EN RD LYL + VK+S L+ KS+I GN V++ Sbjct: 3137 SLQNDSVKVRSDLENVRDLALYLPSQDGRLVKSSILVFDDAPHYKSRIQGNIGVQMLVDL 3196 Query: 445 SQ 450 SQ Sbjct: 3197 SQ 3198 >AB018273-1|BAA34450.1| 1004|Homo sapiens KIAA0730 protein protein. Length = 1004 Score = 31.1 bits (67), Expect = 2.7 Identities = 21/62 (33%), Positives = 31/62 (50%), Gaps = 5/62 (8%) Frame = +1 Query: 280 NFRNSFSATESEMENSRDPILYLGLESST*VKTSALL-----RSKSQILGNTAVKVAAPY 444 + +N S++EN RD LYL + VK+S L+ KS+I GN V++ Sbjct: 312 SLQNDSVKVRSDLENVRDLALYLPSQDGRLVKSSILVFDDAPHYKSRIQGNIGVQMLVDL 371 Query: 445 SQ 450 SQ Sbjct: 372 SQ 373 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 71,264,617 Number of Sequences: 237096 Number of extensions: 1312637 Number of successful extensions: 2011 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 1981 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2011 length of database: 76,859,062 effective HSP length: 86 effective length of database: 56,468,806 effective search space used: 5421005376 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -