BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0205.Seq (329 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0655 + 5546293-5546478,5546760-5546877,5550697-5550776,555... 28 2.0 04_04_0433 + 25163111-25163471,25163943-25164154,25164420-251647... 28 2.0 08_01_0025 - 184899-185384,185707-185940,187156-187341,188108-18... 27 2.7 03_05_0377 + 23613181-23613342,23614469-23614501,23614606-236148... 26 6.2 03_05_0379 + 23628200-23628366,23629074-23629133,23630177-236302... 26 8.3 02_05_0042 + 25351648-25351724,25351983-25352010,25352311-253523... 26 8.3 >12_01_0655 + 5546293-5546478,5546760-5546877,5550697-5550776, 5551329-5552345,5552523-5553344,5553528-5553800 Length = 831 Score = 27.9 bits (59), Expect = 2.0 Identities = 15/43 (34%), Positives = 19/43 (44%) Frame = +3 Query: 54 CTTAVQRSAQNWHGQGESDCLIKTKHCDGPRGC*RNVISAQCS 182 C T RS N H + CL+ +H G NVI +CS Sbjct: 242 CDTERARSDTNEHNIYDGCCLLDVQHTQSFPGNGANVIPTKCS 284 >04_04_0433 + 25163111-25163471,25163943-25164154,25164420-25164701, 25164794-25164916,25165511-25165664,25165754-25165965, 25166143-25166212,25166294-25166424 Length = 514 Score = 27.9 bits (59), Expect = 2.0 Identities = 15/44 (34%), Positives = 20/44 (45%), Gaps = 1/44 (2%) Frame = +3 Query: 54 CTTAVQRSAQNWHGQGESDCLIKTKHCDGPRGC-*RNVISAQCS 182 CT++ +R A W G G L HC P V+S +CS Sbjct: 26 CTSSSRRRASPWGGAGRLIRLRLRGHCPSPASARAARVVSPRCS 69 >08_01_0025 - 184899-185384,185707-185940,187156-187341,188108-188158 Length = 318 Score = 27.5 bits (58), Expect = 2.7 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = -3 Query: 117 LDSRIPLVRASSELTVERRSYRIVPIAHETKPTRP 13 LD+ IP+ R E + E R I+P + P+ P Sbjct: 274 LDNEIPITRTKIESSSEVRDLEILPTGNAALPSSP 308 >03_05_0377 + 23613181-23613342,23614469-23614501,23614606-23614879, 23615105-23615585,23616174-23616846 Length = 540 Score = 26.2 bits (55), Expect = 6.2 Identities = 11/20 (55%), Positives = 11/20 (55%) Frame = -2 Query: 148 PRGPSQCFVLIRQSDSPCPC 89 P G S CF Q SPCPC Sbjct: 246 PCGVSFCFNCAGQVHSPCPC 265 >03_05_0379 + 23628200-23628366,23629074-23629133,23630177-23630209, 23630253-23630665,23631522-23632008,23632623-23633334 Length = 623 Score = 25.8 bits (54), Expect = 8.3 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -2 Query: 148 PRGPSQCFVLIRQSDSPCPC 89 P G S CF + SPCPC Sbjct: 316 PCGASFCFGCAAPAHSPCPC 335 >02_05_0042 + 25351648-25351724,25351983-25352010,25352311-25352373, 25352880-25352945,25353029-25353076,25353338-25353379, 25353499-25353714,25354066-25354188,25354352-25354564, 25354930-25355016,25355259-25355507,25356386-25356507, 25357135-25357225,25358467-25358882,25359489-25359609 Length = 653 Score = 25.8 bits (54), Expect = 8.3 Identities = 13/44 (29%), Positives = 23/44 (52%) Frame = -3 Query: 264 RLFATLKRVIVTPAVYPRLLEFLHVDIQSTGQKSHCVNTREGHR 133 R FA ++ V + RL++F+ VD+ + V+ R+G R Sbjct: 26 RFFAWHIQIEVDHMLSERLMQFIDVDLHGVKAREKFVSVRKGTR 69 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 8,670,193 Number of Sequences: 37544 Number of extensions: 151847 Number of successful extensions: 307 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 303 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 307 length of database: 14,793,348 effective HSP length: 72 effective length of database: 12,090,180 effective search space used: 447336660 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -