BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0203.Seq (587 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding pr... 26 0.79 AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical prot... 23 5.5 >AJ618922-1|CAF02001.1| 272|Anopheles gambiae odorant-binding protein OBPjj5a protein. Length = 272 Score = 26.2 bits (55), Expect = 0.79 Identities = 10/23 (43%), Positives = 13/23 (56%) Frame = -1 Query: 122 NCRWMIHFHHHSRNCIHKCCYRQ 54 NCR +H SRN + CY+Q Sbjct: 151 NCRTAARRNHSSRNTCRRNCYQQ 173 Score = 23.0 bits (47), Expect = 7.3 Identities = 8/23 (34%), Positives = 12/23 (52%) Frame = -1 Query: 236 NCRWMIHFHHDCRNCIHKCCYRR 168 NCR +H RN + CY++ Sbjct: 151 NCRTAARRNHSSRNTCRRNCYQQ 173 >AJ439060-16|CAD27767.1| 278|Anopheles gambiae hypothetical protein protein. Length = 278 Score = 23.4 bits (48), Expect = 5.5 Identities = 16/73 (21%), Positives = 36/73 (49%), Gaps = 4/73 (5%) Frame = +2 Query: 257 QTLQDPVHRAVAA-LMDTVPTVV---MEVYHPRAVPVTLMQAQTLQDPVHPAVAALMDIA 424 +T+ PV + V + VP V ++VY P+ P+ + Q ++ P++ + +++ Sbjct: 164 KTVPVPVFQKVGVPVPHPVPIAVPHYVKVYIPQPYPLQVNVEQPIKIPIYKVIPKVIEKP 223 Query: 425 QAIVMEVYWPLAV 463 +E +P+ V Sbjct: 224 VPYTVEKPYPIEV 236 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 587,974 Number of Sequences: 2352 Number of extensions: 12046 Number of successful extensions: 30 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 30 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 56347938 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -