BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0201.Seq (449 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At4g36020.1 68417.m05128 cold-shock DNA-binding family protein c... 33 0.089 At3g43590.1 68416.m04638 zinc knuckle (CCHC-type) family protein... 33 0.12 At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing ... 32 0.21 At1g75660.1 68414.m08789 5'-3' exoribonuclease (XRN3) identical ... 29 1.1 At4g21840.1 68417.m03158 methionine sulfoxide reductase domain-c... 29 1.5 At4g21830.1 68417.m03157 methionine sulfoxide reductase domain-c... 29 1.5 At4g04220.1 68417.m00598 disease resistance family protein conta... 29 1.5 At1g75560.1 68414.m08781 zinc knuckle (CCHC-type) family protein... 29 1.9 At4g10390.1 68417.m01705 protein kinase family protein contains ... 28 2.5 At3g62330.1 68416.m07002 zinc knuckle (CCHC-type) family protein... 28 3.4 At1g54490.1 68414.m06215 5'-3' exoribonuclease (XRN4) identical ... 28 3.4 At5g52380.1 68418.m06499 zinc knuckle (CCHC-type) family protein... 27 4.4 At1g10390.1 68414.m01171 nucleoporin family protein contains Pfa... 27 4.4 At5g07870.1 68418.m00906 transferase family protein similar to a... 27 5.9 At5g07860.1 68418.m00904 transferase family protein similar to a... 27 5.9 At4g38680.1 68417.m05477 cold-shock DNA-binding family protein c... 27 5.9 At2g33360.1 68415.m04089 expressed protein 27 5.9 At2g28620.1 68415.m03479 kinesin motor protein-related 27 5.9 At2g18915.2 68415.m02208 F-box family protein / LOV kelch protei... 27 5.9 At2g18915.1 68415.m02207 F-box family protein / LOV kelch protei... 27 5.9 At1g75880.2 68414.m08814 family II extracellular lipase 1 (EXL1)... 27 5.9 At1g75880.1 68414.m08813 family II extracellular lipase 1 (EXL1)... 27 5.9 At5g51070.1 68418.m06330 ATP-dependent Clp protease ATP-binding ... 27 7.7 At5g36240.1 68418.m04372 zinc knuckle (CCHC-type) family protein... 27 7.7 At5g20610.1 68418.m02448 expressed protein 27 7.7 At2g30220.1 68415.m03676 GDSL-motif lipase/hydrolase family prot... 27 7.7 At2g21060.1 68415.m02500 cold-shock DNA-binding family protein /... 27 7.7 At2g17870.1 68415.m02070 cold-shock DNA-binding family protein c... 27 7.7 >At4g36020.1 68417.m05128 cold-shock DNA-binding family protein contains Pfam domains, PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 299 Score = 33.1 bits (72), Expect = 0.089 Identities = 15/39 (38%), Positives = 17/39 (43%) Frame = -1 Query: 140 CYVCGDASHVASGCSMRYKKKNDTAPGAVAGATRDVNVC 24 CY CGD HVA C+ + D GAV G C Sbjct: 166 CYTCGDVGHVARDCTQKSVGNGDQR-GAVKGGNDGCYTC 203 Score = 29.9 bits (64), Expect = 0.83 Identities = 11/31 (35%), Positives = 15/31 (48%) Frame = -1 Query: 140 CYVCGDASHVASGCSMRYKKKNDTAPGAVAG 48 CY CGD H A C+ + N + G +G Sbjct: 200 CYTCGDVGHFARDCTQKVAAGNVRSGGGGSG 230 >At3g43590.1 68416.m04638 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 551 Score = 32.7 bits (71), Expect = 0.12 Identities = 18/53 (33%), Positives = 26/53 (49%), Gaps = 4/53 (7%) Frame = -1 Query: 164 PGSRLQ--VSCYVCGDASHVASGCSMRYKK--KNDTAPGAVAGATRDVNVCSR 18 PG+ L VSCY CG H C Y++ +ND+A +R+ + C R Sbjct: 277 PGNSLSWAVSCYRCGQLGHSGLACGRHYEESNENDSATPERLFNSREASECYR 329 Score = 30.7 bits (66), Expect = 0.48 Identities = 15/49 (30%), Positives = 22/49 (44%), Gaps = 1/49 (2%) Frame = -1 Query: 146 VSCYVCGDASHVASGCSMRYKKKNDTAPGAVAGA-TRDVNVCSRASVCY 3 VSCY CG+ H + C K++ P + G+ CS+ CY Sbjct: 166 VSCYSCGEQGHTSFNCPTPTKRRK---PCFICGSLEHGAKQCSKGHDCY 211 Score = 23.4 bits (48), Expect(2) = 2.3 Identities = 8/14 (57%), Positives = 11/14 (78%) Frame = -1 Query: 266 RKTWHRAEGCCDRY 225 +KT HRA+ C D+Y Sbjct: 214 KKTGHRAKDCPDKY 227 Score = 23.4 bits (48), Expect(2) = 2.3 Identities = 12/35 (34%), Positives = 16/35 (45%) Frame = -1 Query: 179 PHPWAPGSRLQVSCYVCGDASHVASGCSMRYKKKN 75 P + GS+ V C CGD H C Y K++ Sbjct: 224 PDKYKNGSKGAV-CLRCGDFGHDMILCKYEYSKED 257 >At3g55340.1 68416.m06146 RNA recognition motif (RRM)-containing protein low similarity to nucleolar phosphoprotein (Nopp52), Tetrahymena thermophila, EMBL:TT51555; contains InterPro entry IPR000504: RNA-binding region RNP-1 (RNA recognition motif) (RRM) Length = 597 Score = 31.9 bits (69), Expect = 0.21 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -1 Query: 140 CYVCGDASHVASGCSMRYKKKNDTAPGAVAGATRD 36 CY CG+ H+++ C ++ +K +D A + T D Sbjct: 397 CYECGEKGHLSTACPIKLQKADDQANSKLGQETVD 431 Score = 27.9 bits (59), Expect = 3.4 Identities = 8/22 (36%), Positives = 15/22 (68%) Frame = -1 Query: 143 SCYVCGDASHVASGCSMRYKKK 78 +CY CG+ H++S C + +K+ Sbjct: 575 NCYECGEKGHLSSACPNKLQKQ 596 Score = 27.1 bits (57), Expect = 5.9 Identities = 7/25 (28%), Positives = 16/25 (64%) Frame = -1 Query: 143 SCYVCGDASHVASGCSMRYKKKNDT 69 +CY CG+ H+++ C ++ + + T Sbjct: 480 NCYECGEKGHLSTACPIKLQNTSHT 504 >At1g75660.1 68414.m08789 5'-3' exoribonuclease (XRN3) identical to XRN3 [Arabidopsis thaliana] gi|11875628|gb|AAG40732 Length = 1020 Score = 29.5 bits (63), Expect = 1.1 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = -1 Query: 170 WAPGSRLQVSCYVCGDASHVASGCSMRYKKK 78 + PG Q C++CG H AS C + KK+ Sbjct: 256 YTPGQ--QERCFLCGQMGHFASNCEGKPKKR 284 >At4g21840.1 68417.m03158 methionine sulfoxide reductase domain-containing protein / SelR domain-containing protein weak similarity to pilin-like transcription factor [Homo sapiens] GI:5059062, SP|P14930 Peptide methionine sulfoxide reductase msrA/msrB (EC 1.8.4.6) {Neisseria gonorrhoeae}; contains Pfam profile PF01641: SelR domain Length = 143 Score = 29.1 bits (62), Expect = 1.5 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -1 Query: 212 FFD-IPAKPEQPPHPWAPGSRLQVSCYVC-GDASHVASG 102 FFD IP +Q P A G R++++C VC G HV G Sbjct: 80 FFDAIPGAIKQTPE--AGGRRMEITCAVCDGHLGHVFKG 116 >At4g21830.1 68417.m03157 methionine sulfoxide reductase domain-containing protein / SeIR domain-containing protein low similarity to pilin-like transcription factor [Homo sapiens] GI:5059062, SP|P14930 Peptide methionine sulfoxide reductase msrA/msrB (EC 1.8.4.6) {Neisseria gonorrhoeae}; contains Pfam profile PF01641: SelR domain Length = 144 Score = 29.1 bits (62), Expect = 1.5 Identities = 17/39 (43%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -1 Query: 212 FFD-IPAKPEQPPHPWAPGSRLQVSCYVC-GDASHVASG 102 FFD IP +Q P A G R++++C VC G HV G Sbjct: 81 FFDAIPGAIKQTPE--AGGRRMEITCAVCDGHLGHVFKG 117 >At4g04220.1 68417.m00598 disease resistance family protein contains leucine rich-repeat (LRR) domains Pfam:PF00560, INTERPRO:IPR001611; similar to Hcr2-2A [Lycopersicon pimpinellifolium] gi|3894389|gb|AAC78594 Length = 811 Score = 29.1 bits (62), Expect = 1.5 Identities = 12/36 (33%), Positives = 21/36 (58%) Frame = -2 Query: 256 GIVPKGVATDTALKLFSIFQQNLNNLLIRGLPALAC 149 G +P+G++ T+LK+ + + NL+ L L L C Sbjct: 551 GSIPEGISNLTSLKVLDLSENNLDGYLPSSLGNLTC 586 >At1g75560.1 68414.m08781 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 257 Score = 28.7 bits (61), Expect = 1.9 Identities = 25/108 (23%), Positives = 47/108 (43%), Gaps = 2/108 (1%) Frame = -1 Query: 341 KRKNEDPDKEPKRSRSFFPWKLPFLRKTWHRAEGCCDRYCSQTFF--DIPAKPEQPPHPW 168 + ++ ++ RSRS ++ R ++H A +R + F ++ ++P H Sbjct: 8 RSRSRSRSRDRFRSRSPRDRRMRSERVSYHDAPSRREREPRRAFSQGNLCNNCKRPGHFA 67 Query: 167 APGSRLQVSCYVCGDASHVASGCSMRYKKKNDTAPGAVAGATRDVNVC 24 S + V C CG H+A+ C+ + N PG VA + +C Sbjct: 68 RDCSNVSV-CNNCGLPGHIAAECTAESRCWNCREPGHVASNCSNEGIC 114 >At4g10390.1 68417.m01705 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 342 Score = 28.3 bits (60), Expect = 2.5 Identities = 19/58 (32%), Positives = 28/58 (48%), Gaps = 7/58 (12%) Frame = +3 Query: 39 SGCTCHSTWSSVVFL------LVAHGTPRS-YMTRITAHVTADLQARAGSPRMRRLFR 191 SG TC+++W V L L+ G S YM R + A L+ S R+ ++FR Sbjct: 25 SGVTCYNSWDDVETLTSNFSRLIGSGGYSSIYMARFSGSDKAALKVHVSSHRLYQVFR 82 >At3g62330.1 68416.m07002 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 479 Score = 27.9 bits (59), Expect = 3.4 Identities = 9/33 (27%), Positives = 15/33 (45%) Frame = -1 Query: 197 AKPEQPPHPWAPGSRLQVSCYVCGDASHVASGC 99 AK + W ++ C +CG++ H GC Sbjct: 75 AKSKATERNWKKRKEEEMICKICGESGHFTQGC 107 >At1g54490.1 68414.m06215 5'-3' exoribonuclease (XRN4) identical to XRN4 [Arabidopsis thaliana] GI:11875626; contains Pfam domain PF03159: Putative 5'-3' exonuclease domain Length = 947 Score = 27.9 bits (59), Expect = 3.4 Identities = 11/28 (39%), Positives = 13/28 (46%) Frame = -1 Query: 149 QVSCYVCGDASHVASGCSMRYKKKNDTA 66 Q C+VCG H AS C + N A Sbjct: 262 QEKCFVCGQTGHFASDCPGKSGSNNAAA 289 >At5g52380.1 68418.m06499 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 268 Score = 27.5 bits (58), Expect = 4.4 Identities = 8/27 (29%), Positives = 13/27 (48%) Frame = -1 Query: 179 PHPWAPGSRLQVSCYVCGDASHVASGC 99 P+P G SC++C H++ C Sbjct: 141 PYPMEDGGTKFASCFICKGQGHISKNC 167 >At1g10390.1 68414.m01171 nucleoporin family protein contains Pfam profiles: PF04096 nucleoporin autopeptidase, PF03093 nucleoporin FG repeat family Length = 1041 Score = 27.5 bits (58), Expect = 4.4 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +3 Query: 216 LRAVSVATPFGTMPGFPQ 269 L+ V+V PFGT+P PQ Sbjct: 667 LQPVAVTNPFGTLPAMPQ 684 >At5g07870.1 68418.m00906 transferase family protein similar to anthranilate N-hydroxycinnamoyl/benzoyltransferase, Dianthus caryophyllus [gi:2239091]; contains Pfam transferase family domain PF002458 Length = 464 Score = 27.1 bits (57), Expect = 5.9 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -1 Query: 128 GDASHVASGCSMRYKKKNDTAPGAVAGATRDVNVC 24 G A V SG +Y K PG GA+ D+ VC Sbjct: 407 GKAVAVRSGYGGKYDGKVSAYPGRQGGASIDLEVC 441 >At5g07860.1 68418.m00904 transferase family protein similar to anthranilate N-hydroxycinnamoyl/benzoyltransferase, Dianthus caryophyllus [gi:2239091]; contains Pfam transferase family domain PF002458 Length = 454 Score = 27.1 bits (57), Expect = 5.9 Identities = 14/35 (40%), Positives = 17/35 (48%) Frame = -1 Query: 128 GDASHVASGCSMRYKKKNDTAPGAVAGATRDVNVC 24 G A V SG +Y K PG GA+ D+ VC Sbjct: 395 GKAVAVRSGYGGKYDGKVSAYPGREGGASIDLEVC 429 >At4g38680.1 68417.m05477 cold-shock DNA-binding family protein contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 203 Score = 27.1 bits (57), Expect = 5.9 Identities = 10/22 (45%), Positives = 12/22 (54%) Frame = -1 Query: 161 GSRLQVSCYVCGDASHVASGCS 96 G R CY CG+ H+A CS Sbjct: 124 GGRGGSDCYKCGEPGHMARDCS 145 >At2g33360.1 68415.m04089 expressed protein Length = 603 Score = 27.1 bits (57), Expect = 5.9 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = +3 Query: 33 DVSGCTCHSTWSSVVFLLVAHGTPRS 110 D S C+ HST VV L HG PR+ Sbjct: 467 DASKCSKHSTSIDVVIPLGIHGGPRN 492 >At2g28620.1 68415.m03479 kinesin motor protein-related Length = 1076 Score = 27.1 bits (57), Expect = 5.9 Identities = 15/48 (31%), Positives = 24/48 (50%) Frame = +2 Query: 188 QVLLEYRKKFESSICRNTLRHDARFSAEMAASTEKNFESVLVLYQDLR 331 Q L + KKFE SI + + + +A+S + E V + QD+R Sbjct: 749 QKLSAFTKKFEESIANEEKQMLEKVAELLASSNARKKELVQIAVQDIR 796 >At2g18915.2 68415.m02208 F-box family protein / LOV kelch protein 2 (LKP2) / adagio 2 (ADO2) E3 ubiquitin ligase SCF complex F-box subunit; identical to Adagio 2 GI:13487070 from [Arabidopsis thaliana]; contains Pfam profiles PF01344: Kelch motif and PF00646: F-box domain; identical to cDNA LOV kelch protein 2 GI:18146957; identical to cDNA Adagio 2 (ADO2) GI:13487069 Length = 611 Score = 27.1 bits (57), Expect = 5.9 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = -1 Query: 233 DRYCSQTFFDIPAKPEQPPHPWAPGSRLQVSCYVCGD 123 D + DIPA E P PW P SRL + V GD Sbjct: 426 DTFLLDLSMDIPAWREIPV-PWTPPSRLGHTLTVYGD 461 >At2g18915.1 68415.m02207 F-box family protein / LOV kelch protein 2 (LKP2) / adagio 2 (ADO2) E3 ubiquitin ligase SCF complex F-box subunit; identical to Adagio 2 GI:13487070 from [Arabidopsis thaliana]; contains Pfam profiles PF01344: Kelch motif and PF00646: F-box domain; identical to cDNA LOV kelch protein 2 GI:18146957; identical to cDNA Adagio 2 (ADO2) GI:13487069 Length = 601 Score = 27.1 bits (57), Expect = 5.9 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = -1 Query: 233 DRYCSQTFFDIPAKPEQPPHPWAPGSRLQVSCYVCGD 123 D + DIPA E P PW P SRL + V GD Sbjct: 416 DTFLLDLSMDIPAWREIPV-PWTPPSRLGHTLTVYGD 451 >At1g75880.2 68414.m08814 family II extracellular lipase 1 (EXL1) EXL1 (PMID:11431566); similar to anter-specific proline-rich protein (APG) SP:P40602 [Arabidopsis thaliana] Length = 374 Score = 27.1 bits (57), Expect = 5.9 Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = -2 Query: 388 LPQKIVYFTHYV----ALPSKEKTKILIKN 311 LPQ+++YF Y+ + +++TK +IKN Sbjct: 152 LPQQLIYFEEYIEKLKQMVGEKRTKFIIKN 181 >At1g75880.1 68414.m08813 family II extracellular lipase 1 (EXL1) EXL1 (PMID:11431566); similar to anter-specific proline-rich protein (APG) SP:P40602 [Arabidopsis thaliana] Length = 375 Score = 27.1 bits (57), Expect = 5.9 Identities = 11/30 (36%), Positives = 20/30 (66%), Gaps = 4/30 (13%) Frame = -2 Query: 388 LPQKIVYFTHYV----ALPSKEKTKILIKN 311 LPQ+++YF Y+ + +++TK +IKN Sbjct: 153 LPQQLIYFEEYIEKLKQMVGEKRTKFIIKN 182 >At5g51070.1 68418.m06330 ATP-dependent Clp protease ATP-binding subunit (ClpD), (ERD1) SAG15/ERD1; identical to ERD1 protein GI:497629, SP:P42762 from [Arabidopsis thaliana]; contains Pfam profile PF02861: Clp amino terminal domain Length = 945 Score = 26.6 bits (56), Expect = 7.7 Identities = 11/28 (39%), Positives = 21/28 (75%), Gaps = 1/28 (3%) Frame = +2 Query: 164 EPTDEEVVQVLLEYRKKFES-SICRNTL 244 EP++E+ V++LL R+K+E+ C+ T+ Sbjct: 454 EPSEEDAVKILLGLREKYEAHHNCKYTM 481 >At5g36240.1 68418.m04372 zinc knuckle (CCHC-type) family protein contains Pfam domain, PF00098: Zinc knuckle Length = 254 Score = 26.6 bits (56), Expect = 7.7 Identities = 9/20 (45%), Positives = 9/20 (45%) Frame = -1 Query: 146 VSCYVCGDASHVASGCSMRY 87 VSCY CG H C Y Sbjct: 77 VSCYRCGQLGHTGLACGRHY 96 >At5g20610.1 68418.m02448 expressed protein Length = 1164 Score = 26.6 bits (56), Expect = 7.7 Identities = 10/27 (37%), Positives = 14/27 (51%) Frame = -1 Query: 314 EPKRSRSFFPWKLPFLRKTWHRAEGCC 234 EPK +SF+ W L + +R CC Sbjct: 54 EPKEKKSFWNWPLRAINHVRNRRFNCC 80 >At2g30220.1 68415.m03676 GDSL-motif lipase/hydrolase family protein similar to family II lipases EXL3 GI:15054386, EXL1 GI:15054382, EXL2 GI:15054384 from [Arabidopsis thaliana]; contains Pfam profile PF00657: GDSL-like Lipase/Acylhydrolase Length = 358 Score = 26.6 bits (56), Expect = 7.7 Identities = 17/64 (26%), Positives = 29/64 (45%), Gaps = 2/64 (3%) Frame = -2 Query: 205 IFQQNLNNLLIRGLPALACKSAVTCAVMRVM*LLGVPCATRRKTTLL--QVLWQVQPETS 32 ++ N+L+ GLP + C A +R +LG+ K ++L Q L + PE Sbjct: 210 LYSLGCRNILVGGLPPMGCLPIQLTAKLRT--ILGICVEQENKDSILYNQKLVKKLPEIQ 267 Query: 31 TCVP 20 +P Sbjct: 268 ASLP 271 >At2g21060.1 68415.m02500 cold-shock DNA-binding family protein / glycine-rich protein (GRP2) identical to Glycine-rich protein 2b (AtGRP2b) [Arabidopsis thaliana] SWISS-PROT:Q38896; contains Pfam domains PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 201 Score = 26.6 bits (56), Expect = 7.7 Identities = 8/17 (47%), Positives = 12/17 (70%) Frame = -1 Query: 146 VSCYVCGDASHVASGCS 96 +SCY CG++ H A C+ Sbjct: 180 LSCYSCGESGHFARDCT 196 >At2g17870.1 68415.m02070 cold-shock DNA-binding family protein contains Pfam domains, PF00313: 'Cold-shock' DNA-binding domain and PF00098: Zinc knuckle Length = 301 Score = 26.6 bits (56), Expect = 7.7 Identities = 8/14 (57%), Positives = 9/14 (64%) Frame = -1 Query: 140 CYVCGDASHVASGC 99 CY+CGD H A C Sbjct: 132 CYMCGDVGHFARDC 145 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,264,150 Number of Sequences: 28952 Number of extensions: 207009 Number of successful extensions: 759 Number of sequences better than 10.0: 28 Number of HSP's better than 10.0 without gapping: 704 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 755 length of database: 12,070,560 effective HSP length: 75 effective length of database: 9,899,160 effective search space used: 732537840 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -