BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0200.Seq (548 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17803| Best HMM Match : SRCR (HMM E-Value=0) 29 3.3 SB_23399| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.8 >SB_17803| Best HMM Match : SRCR (HMM E-Value=0) Length = 1428 Score = 28.7 bits (61), Expect = 3.3 Identities = 12/21 (57%), Positives = 14/21 (66%) Frame = +1 Query: 166 SATTLSACSSVGCSKSIRIWL 228 SAT+ S C G SKS R+WL Sbjct: 186 SATSTSCCGKYGPSKSRRVWL 206 >SB_23399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 827 Score = 27.9 bits (59), Expect = 5.8 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 2/39 (5%) Frame = -1 Query: 125 LNKYNAPGFVGLITH*VLKKLSRFRTK--FNVYIPKCFD 15 L + + PG GL + LK+ SR+ N+Y+P FD Sbjct: 302 LERTDKPGISGLTSKEFLKEFSRYHPNGTANLYVPYAFD 340 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,481,039 Number of Sequences: 59808 Number of extensions: 289762 Number of successful extensions: 595 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 554 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 595 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1264269032 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -