BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0179.Seq (327 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 23 1.1 DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 prot... 23 1.1 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 22 1.4 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 1.9 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 1.9 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 1.9 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 1.9 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 3.3 AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve co... 21 3.3 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 4.3 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.6 bits (46), Expect = 1.1 Identities = 9/28 (32%), Positives = 14/28 (50%) Frame = -2 Query: 215 GSPLCSPRRCPANACPLYRWIRQRPGYP 132 G+P+C NA L +W + G+P Sbjct: 324 GNPICVQIPWDKNAEALAKWANGQTGFP 351 >DQ659247-1|ABG47445.1| 980|Tribolium castaneum chitinase 7 protein. Length = 980 Score = 22.6 bits (46), Expect = 1.1 Identities = 9/25 (36%), Positives = 13/25 (52%) Frame = -2 Query: 212 SPLCSPRRCPANACPLYRWIRQRPG 138 SP+ R P C + W ++RPG Sbjct: 513 SPISKKVRPPQVLCYITSWSQKRPG 537 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 22.2 bits (45), Expect = 1.4 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = +1 Query: 202 HRGEPSSLSPTPIQ 243 H GEP+ L+P IQ Sbjct: 217 HTGEPTDLTPEQIQ 230 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 1.9 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +2 Query: 2 LVFRVVINTRIKK*STMSTYFQYPTPELQEELKKIAQA-IVAPAKGILAADESTGT 166 L+ +IN + T + EL+EE K+ +A A K +L +S GT Sbjct: 1046 LILYSIINLNVVSWGTREVAVKKTKKELEEEKKQAEEAKRKAKQKSLLGFLQSGGT 1101 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 1.9 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +2 Query: 2 LVFRVVINTRIKK*STMSTYFQYPTPELQEELKKIAQA-IVAPAKGILAADESTGT 166 L+ +IN + T + EL+EE K+ +A A K +L +S GT Sbjct: 1046 LILYSIINLNVVSWGTREVAVKKTKKELEEEKKQAEEAKRKAKQKSLLGFLQSGGT 1101 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 1.9 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +2 Query: 2 LVFRVVINTRIKK*STMSTYFQYPTPELQEELKKIAQA-IVAPAKGILAADESTGT 166 L+ +IN + T + EL+EE K+ +A A K +L +S GT Sbjct: 1046 LILYSIINLNVVSWGTREVAVKKTKKELEEEKKQAEEAKRKAKQKSLLGFLQSGGT 1101 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 1.9 Identities = 16/56 (28%), Positives = 25/56 (44%), Gaps = 1/56 (1%) Frame = +2 Query: 2 LVFRVVINTRIKK*STMSTYFQYPTPELQEELKKIAQA-IVAPAKGILAADESTGT 166 L+ +IN + T + EL+EE K+ +A A K +L +S GT Sbjct: 1046 LILYSIINLNVVSWGTREVAVKKTKKELEEEKKQAEEAKRKAKQKSLLGFLQSGGT 1101 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.0 bits (42), Expect = 3.3 Identities = 8/28 (28%), Positives = 13/28 (46%) Frame = -2 Query: 221 DDGSPLCSPRRCPANACPLYRWIRQRPG 138 ++G+ C CP CP + + PG Sbjct: 699 ENGNNKCFTMECPQVTCPDNMKLEKVPG 726 >AY695256-1|AAW21973.1| 168|Tribolium castaneum ventral nerve cord defective protein protein. Length = 168 Score = 21.0 bits (42), Expect = 3.3 Identities = 8/16 (50%), Positives = 11/16 (68%) Frame = -2 Query: 236 GVGDNDDGSPLCSPRR 189 G+ D + +PL SPRR Sbjct: 103 GMHDQQNNNPLPSPRR 118 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 20.6 bits (41), Expect = 4.3 Identities = 13/37 (35%), Positives = 14/37 (37%), Gaps = 3/37 (8%) Frame = +3 Query: 150 TNPPVQWASVCRTSAW---RTQRRTVVVIANSYSALT 251 T P W S TS W T RRT + S T Sbjct: 1036 TTKPSTWWSSTTTSPWWTTTTTRRTTTTRPTTTSTTT 1072 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 72,867 Number of Sequences: 336 Number of extensions: 1351 Number of successful extensions: 10 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 10 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 49 effective length of database: 106,121 effective search space used: 6261139 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 38 (20.3 bits)
- SilkBase 1999-2023 -