BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0175.Seq (538 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_17004| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_48151| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 >SB_17004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 27.9 bits (59), Expect = 5.6 Identities = 14/45 (31%), Positives = 23/45 (51%), Gaps = 3/45 (6%) Frame = -2 Query: 150 FFLIIK*L---INCDQCKWFVFDFIGKCSFDSPLNIHPI*DLDIG 25 F ++I+ L I + C F+ + G+ D P N+HP D +G Sbjct: 11 FVIVIRSLLVRIRLEGCFTFIAVYFGQGYVDCPFNVHPSFDSSVG 55 >SB_48151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 655 Score = 27.9 bits (59), Expect = 5.6 Identities = 11/37 (29%), Positives = 23/37 (62%) Frame = +3 Query: 261 TPHQILFTPKQNAASKILVVVVINAKPNEMLPIIQNK 371 +P + +F+PK A + +V ++IN++ +L + Q K Sbjct: 474 SPREEIFSPKAQLAIEAIVNMIINSQVQTLLRVFQYK 510 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,308,897 Number of Sequences: 59808 Number of extensions: 294430 Number of successful extensions: 546 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 518 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 546 length of database: 16,821,457 effective HSP length: 78 effective length of database: 12,156,433 effective search space used: 1215643300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -