BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0175.Seq (538 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. 25 2.1 DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor... 23 8.6 >CR954257-2|CAJ14153.1| 1664|Anopheles gambiae Tubby protein. Length = 1664 Score = 24.6 bits (51), Expect = 2.1 Identities = 17/59 (28%), Positives = 25/59 (42%), Gaps = 1/59 (1%) Frame = +2 Query: 104 HLHWSQLISYLIIKKKYYQCYCCVPW-SRSRIT*LVGITFVYLHTKNSTLLPWYTTPNL 277 H H Q + + + YYQ W + + +VG+TF H K + P T NL Sbjct: 6 HFHELQEEGWKLNRTNYYQ----EGWLATGNVRGIVGVTFTTSHCKKNVDYPLRTNYNL 60 >DQ989013-1|ABK97614.1| 378|Anopheles gambiae gustatory receptor 24 protein. Length = 378 Score = 22.6 bits (46), Expect = 8.6 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -1 Query: 505 YDWFCQYLFLIITQGQFLVVNQI 437 + + C YLF IIT + +++QI Sbjct: 232 FTFICLYLFFIITLSIYGLMSQI 254 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 537,682 Number of Sequences: 2352 Number of extensions: 10449 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 49897362 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -