BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0175.Seq (538 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value BT012296-1|AAS77421.1| 569|Drosophila melanogaster UT01590p pro... 28 9.3 AE013599-1403|AAF58573.1| 2396|Drosophila melanogaster CG8877-PA... 28 9.3 >BT012296-1|AAS77421.1| 569|Drosophila melanogaster UT01590p protein. Length = 569 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 206 VGITFVYLHTKNSTLLPWYTTPNLVHTKTK 295 + ++Y + + L WY TPN+V+ KT+ Sbjct: 373 IAFPYLYNNMPHFVHLSWYHTPNVVYIKTE 402 >AE013599-1403|AAF58573.1| 2396|Drosophila melanogaster CG8877-PA protein. Length = 2396 Score = 27.9 bits (59), Expect = 9.3 Identities = 10/30 (33%), Positives = 18/30 (60%) Frame = +2 Query: 206 VGITFVYLHTKNSTLLPWYTTPNLVHTKTK 295 + ++Y + + L WY TPN+V+ KT+ Sbjct: 373 IAFPYLYNNMPHFVHLSWYHTPNVVYIKTE 402 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,996,655 Number of Sequences: 53049 Number of extensions: 412346 Number of successful extensions: 960 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 946 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 960 length of database: 24,988,368 effective HSP length: 80 effective length of database: 20,744,448 effective search space used: 2032955904 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -