BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0169.Seq (469 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC4.05 |mlo2||zinc finger protein Mlo2|Schizosaccharomyces pom... 26 2.5 SPAC821.04c |cid13||poly|Schizosaccharomyces pombe|chr 1|||Manual 26 2.5 SPAC1B3.04c |||mitochondrial GTPase Guf1 |Schizosaccharomyces po... 25 5.8 >SPBC4.05 |mlo2||zinc finger protein Mlo2|Schizosaccharomyces pombe|chr 2|||Manual Length = 329 Score = 26.2 bits (55), Expect = 2.5 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = -2 Query: 201 YRCLIQLNTTWSIPCSV*DFKSYLMTSNDFNDNF 100 +RC T SIPC++ + ND+N NF Sbjct: 85 FRCDCGTTRTHSIPCNLRKSVDECGSENDYNHNF 118 >SPAC821.04c |cid13||poly|Schizosaccharomyces pombe|chr 1|||Manual Length = 578 Score = 26.2 bits (55), Expect = 2.5 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = -2 Query: 276 YTSLVKENMPLLRKHIRYSLPSP*EYRCLIQLNTTWSIPCSV*DFKSY 133 Y+S+ ++P + ++ Y+ P Y C I N+ +P S DF ++ Sbjct: 441 YSSIYSNDVPAIPPNVPYTFVDPYTYACYINNNS--YLPPSYMDFYTW 486 >SPAC1B3.04c |||mitochondrial GTPase Guf1 |Schizosaccharomyces pombe|chr 1|||Manual Length = 646 Score = 25.0 bits (52), Expect = 5.8 Identities = 15/51 (29%), Positives = 27/51 (52%) Frame = -2 Query: 306 GVIIQA*TDFYTSLVKENMPLLRKHIRYSLPSP*EYRCLIQLNTTWSIPCS 154 G+ Q ++FY + +N+ ++ + LP+ R LIQ+ T+ IP S Sbjct: 160 GIQAQTLSNFYMAF-SQNLVIIPVLNKVDLPTADVDRTLIQVQQTFDIPMS 209 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,623,714 Number of Sequences: 5004 Number of extensions: 31027 Number of successful extensions: 60 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 59 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 60 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 178394480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -