BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0156.Seq (399 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC1783.08c |rpl1502|rpl15-2|60S ribosomal protein L15b|Schizos... 75 5e-15 SPCC576.11 |rpl15||60S ribosomal protein L15|Schizosaccharomyces... 73 2e-14 SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|c... 25 4.3 SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosacch... 25 4.3 SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase comple... 25 4.3 SPAC23H3.15c ||SPAC25H1.01c|sequence orphan|Schizosaccharomyces ... 25 4.3 SPBC106.18 |rpl2501|rpl25a|60S ribosomal protein L25|Schizosacch... 25 5.7 SPAC9E9.03 |leu2||3-isopropylmalate dehydratase Leu2 |Schizosacc... 25 5.7 SPBP22H7.02c |||RNA-binding protein Mrd1 |Schizosaccharomyces po... 24 7.6 SPCC1235.08c |pdh1||DUF1751 family protein|Schizosaccharomyces p... 24 10.0 SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pomb... 24 10.0 >SPAC1783.08c |rpl1502|rpl15-2|60S ribosomal protein L15b|Schizosaccharomyces pombe|chr 1|||Manual Length = 201 Score = 74.5 bits (175), Expect = 5e-15 Identities = 35/54 (64%), Positives = 40/54 (74%) Frame = -1 Query: 252 IVNAVHKHREMRGLTSAGRSSRGLGKGHRYSQTKGGSRRAAWLRRNTLQLRRKR 91 IVN VHKHRE RGLTS G+ SRG+GKGHRY+ + + A WLR NTL LRR R Sbjct: 151 IVNPVHKHRESRGLTSIGKKSRGIGKGHRYNNS---PQHATWLRHNTLSLRRYR 201 Score = 63.7 bits (148), Expect = 1e-11 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 347 YWVAQDSSYKYFEVILVDPSHKAIRRDPKIN 255 YWV QD++YK+FEVILVDPSHKAIRRDP+IN Sbjct: 119 YWVNQDATYKFFEVILVDPSHKAIRRDPRIN 149 >SPCC576.11 |rpl15||60S ribosomal protein L15|Schizosaccharomyces pombe|chr 3|||Manual Length = 201 Score = 72.9 bits (171), Expect = 2e-14 Identities = 34/54 (62%), Positives = 40/54 (74%) Frame = -1 Query: 252 IVNAVHKHREMRGLTSAGRSSRGLGKGHRYSQTKGGSRRAAWLRRNTLQLRRKR 91 IVN VHKHRE RGLTS G+ SRG+GKGHR++ + + A WLR NTL LRR R Sbjct: 151 IVNPVHKHRESRGLTSIGKKSRGIGKGHRFNNS---PQHATWLRHNTLSLRRYR 201 Score = 63.7 bits (148), Expect = 1e-11 Identities = 26/31 (83%), Positives = 30/31 (96%) Frame = -2 Query: 347 YWVAQDSSYKYFEVILVDPSHKAIRRDPKIN 255 YWV QD++YK+FEVILVDPSHKAIRRDP+IN Sbjct: 119 YWVNQDATYKFFEVILVDPSHKAIRRDPRIN 149 >SPBC354.08c |||DUF221 family protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 865 Score = 25.0 bits (52), Expect = 4.3 Identities = 6/19 (31%), Positives = 13/19 (68%) Frame = -3 Query: 58 HLLIFVCRWKASGLIKYYC 2 ++++F+C W G ++ YC Sbjct: 649 NIILFLCLWVQGGRVRAYC 667 >SPBC28E12.06c |lvs1|SPBC3H7.16|beige protein homolog|Schizosaccharomyces pombe|chr 2|||Manual Length = 2609 Score = 25.0 bits (52), Expect = 4.3 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -1 Query: 378 SLRWSPCVELLLGCTRFF 325 SL+ P V LL+G TRFF Sbjct: 568 SLKVPPLVPLLIGTTRFF 585 >SPBC12C2.10c |pst1|SPBC21D10.01c|Clr6 histone deacetylase complex subunit Pst1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1522 Score = 25.0 bits (52), Expect = 4.3 Identities = 10/19 (52%), Positives = 13/19 (68%) Frame = -1 Query: 390 ACXPSLRWSPCVELLLGCT 334 +C PS R P +ELLL C+ Sbjct: 595 SCGPSYRLLPKIELLLPCS 613 >SPAC23H3.15c ||SPAC25H1.01c|sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 325 Score = 25.0 bits (52), Expect = 4.3 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 1/34 (2%) Frame = -1 Query: 213 LTSAGRSSRGLGKG-HRYSQTKGGSRRAAWLRRN 115 ++SAG S G GKG + T +RRAA RN Sbjct: 236 VSSAGYSGEGYGKGTYATDTTAEANRRAATGTRN 269 >SPBC106.18 |rpl2501|rpl25a|60S ribosomal protein L25|Schizosaccharomyces pombe|chr 2|||Manual Length = 141 Score = 24.6 bits (51), Expect = 5.7 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +3 Query: 18 NPLAFHLHTKISKWKVTDSFR*MF 89 N L FH+H K +K+ + ++ R ++ Sbjct: 79 NTLVFHVHLKANKFTIKEAVRKLY 102 >SPAC9E9.03 |leu2||3-isopropylmalate dehydratase Leu2 |Schizosaccharomyces pombe|chr 1|||Manual Length = 758 Score = 24.6 bits (51), Expect = 5.7 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 146 AHAGQLGSDATLFNYVAN 93 A AG + DAT F YV N Sbjct: 240 ARAGMIAPDATTFEYVKN 257 >SPBP22H7.02c |||RNA-binding protein Mrd1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 833 Score = 24.2 bits (50), Expect = 7.6 Identities = 10/32 (31%), Positives = 16/32 (50%) Frame = -2 Query: 158 KQREAHAGQLGSDATLFNYVANDKHLSKTVSD 63 KQ E +G + F+ ND+HL + +D Sbjct: 263 KQPEEEVSVVGDELKSFDKENNDEHLERVTND 294 >SPCC1235.08c |pdh1||DUF1751 family protein|Schizosaccharomyces pombe|chr 3|||Manual Length = 226 Score = 23.8 bits (49), Expect = 10.0 Identities = 7/26 (26%), Positives = 14/26 (53%) Frame = -2 Query: 86 HLSKTVSDFPFAYFCMQMESQWVNKI 9 HL FP+ YFC+ + ++++ Sbjct: 178 HLFYVFQSFPWTYFCLAVSGTCISEL 203 >SPBC216.05 |rad3||ATR checkpoint kinase|Schizosaccharomyces pombe|chr 2|||Manual Length = 2386 Score = 23.8 bits (49), Expect = 10.0 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -3 Query: 298 WTRHTRPFVAILRSTDRE 245 W HTRPF IL + R+ Sbjct: 2135 WVNHTRPFREILLKSYRQ 2152 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,518,443 Number of Sequences: 5004 Number of extensions: 25781 Number of successful extensions: 66 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 64 length of database: 2,362,478 effective HSP length: 66 effective length of database: 2,032,214 effective search space used: 134126124 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -