BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0152.Seq (399 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g51800.2 68416.m05681 metallopeptidase M24 family protein sim... 96 9e-21 At3g51800.1 68416.m05680 metallopeptidase M24 family protein sim... 96 9e-21 At2g44180.1 68415.m05496 methionyl aminopeptidase, putative / me... 50 8e-07 At3g59990.2 68416.m06698 methionyl aminopeptidase, putative / me... 46 1e-05 At3g59990.1 68416.m06697 methionyl aminopeptidase, putative / me... 46 1e-05 At1g13270.2 68414.m01540 metallopeptidase M24 family protein sim... 42 2e-04 At1g13270.1 68414.m01541 metallopeptidase M24 family protein sim... 42 2e-04 At4g37040.1 68417.m05246 metallopeptidase M24 family protein sim... 38 0.002 At3g25740.1 68416.m03205 metallopeptidase M24 family protein sim... 38 0.002 At2g45240.1 68415.m05632 methionyl aminopeptidase, putative / me... 29 0.86 At4g29490.1 68417.m04208 Xaa-Pro dipeptidase, putative / prolida... 29 1.5 At1g09300.1 68414.m01041 metallopeptidase M24 family protein sim... 27 6.1 >At3g51800.2 68416.m05681 metallopeptidase M24 family protein similar to SP|P50580 Proliferation-associated protein 2G4 {Mus musculus}; contains Pfam profile PF00557: metallopeptidase family M24 Length = 401 Score = 95.9 bits (228), Expect = 9e-21 Identities = 43/86 (50%), Positives = 62/86 (72%), Gaps = 1/86 (1%) Frame = +1 Query: 1 CEFGDKLVLEETNKVFKKEKDS-KKGIAFSTCVSVNNCICHFSPIASEPDYILKKGDLAK 177 CE GD + E+T ++K K ++G+AF TC+SVNN + HFSP+AS+ + +L+ GD+ K Sbjct: 51 CEKGDSFIKEQTASMYKNSKKKIERGVAFPTCISVNNTVGHFSPLASD-ESVLEDGDMVK 109 Query: 178 IDLGAHIDGFIAVVAHTVVVGESEVS 255 ID+G HIDGFIA+V HT V+ E +S Sbjct: 110 IDMGCHIDGFIALVGHTHVLQEGPLS 135 >At3g51800.1 68416.m05680 metallopeptidase M24 family protein similar to SP|P50580 Proliferation-associated protein 2G4 {Mus musculus}; contains Pfam profile PF00557: metallopeptidase family M24 Length = 392 Score = 95.9 bits (228), Expect = 9e-21 Identities = 43/86 (50%), Positives = 62/86 (72%), Gaps = 1/86 (1%) Frame = +1 Query: 1 CEFGDKLVLEETNKVFKKEKDS-KKGIAFSTCVSVNNCICHFSPIASEPDYILKKGDLAK 177 CE GD + E+T ++K K ++G+AF TC+SVNN + HFSP+AS+ + +L+ GD+ K Sbjct: 51 CEKGDSFIKEQTASMYKNSKKKIERGVAFPTCISVNNTVGHFSPLASD-ESVLEDGDMVK 109 Query: 178 IDLGAHIDGFIAVVAHTVVVGESEVS 255 ID+G HIDGFIA+V HT V+ E +S Sbjct: 110 IDMGCHIDGFIALVGHTHVLQEGPLS 135 >At2g44180.1 68415.m05496 methionyl aminopeptidase, putative / methionine aminopeptidase, putative / peptidase M, putative similar to SP|P50579 Methionine aminopeptidase 2 (EC 3.4.11.18) (MetAP 2) {Homo sapiens}; contains Pfam profile PF00557: metallopeptidase family M24 Length = 441 Score = 49.6 bits (113), Expect = 8e-07 Identities = 27/69 (39%), Positives = 38/69 (55%) Frame = +1 Query: 25 LEETNKVFKKEKDSKKGIAFSTCVSVNNCICHFSPIASEPDYILKKGDLAKIDLGAHIDG 204 LE T + E + GIAF T S+NN H++P + + +L+ D+ K+D G HIDG Sbjct: 163 LENTVRKLISENGLQAGIAFPTGCSLNNVAAHWTPNSGDKT-VLQYDDVMKLDFGTHIDG 221 Query: 205 FIAVVAHTV 231 I A TV Sbjct: 222 HIVDSAFTV 230 >At3g59990.2 68416.m06698 methionyl aminopeptidase, putative / methionine aminopeptidase, putative / peptidase M, putative similar to Methionine aminopeptidase 2 (EC 3.4.11.18) from {Rattus norvegicus} SP|P38062, {Homo sapiens} SP|P50579; contains Pfam profile PF00557: metallopeptidase family M24; supporting cDNA gi|11344921|gb|AF300880.1|AF300880 Length = 439 Score = 45.6 bits (103), Expect = 1e-05 Identities = 26/69 (37%), Positives = 37/69 (53%) Frame = +1 Query: 25 LEETNKVFKKEKDSKKGIAFSTCVSVNNCICHFSPIASEPDYILKKGDLAKIDLGAHIDG 204 LE T + E + GIAF T S+N H++P + + +L+ D+ K+D G HIDG Sbjct: 161 LENTVRKLISENGLQAGIAFPTGCSLNWVAAHWTPNSGDKT-VLQYDDVMKLDFGTHIDG 219 Query: 205 FIAVVAHTV 231 I A TV Sbjct: 220 HIIDCAFTV 228 >At3g59990.1 68416.m06697 methionyl aminopeptidase, putative / methionine aminopeptidase, putative / peptidase M, putative similar to Methionine aminopeptidase 2 (EC 3.4.11.18) from {Rattus norvegicus} SP|P38062, {Homo sapiens} SP|P50579; contains Pfam profile PF00557: metallopeptidase family M24; supporting cDNA gi|11344921|gb|AF300880.1|AF300880 Length = 439 Score = 45.6 bits (103), Expect = 1e-05 Identities = 26/69 (37%), Positives = 37/69 (53%) Frame = +1 Query: 25 LEETNKVFKKEKDSKKGIAFSTCVSVNNCICHFSPIASEPDYILKKGDLAKIDLGAHIDG 204 LE T + E + GIAF T S+N H++P + + +L+ D+ K+D G HIDG Sbjct: 161 LENTVRKLISENGLQAGIAFPTGCSLNWVAAHWTPNSGDKT-VLQYDDVMKLDFGTHIDG 219 Query: 205 FIAVVAHTV 231 I A TV Sbjct: 220 HIIDCAFTV 228 >At1g13270.2 68414.m01540 metallopeptidase M24 family protein similar to SP|Q01662 Methionine aminopeptidase 1 precursor (EC 3.4.11.18) {Saccharomyces cerevisiae}; contains Pfam profile PF00557: metallopeptidase family M24 Length = 283 Score = 41.9 bits (94), Expect = 2e-04 Identities = 20/57 (35%), Positives = 30/57 (52%) Frame = +1 Query: 73 GIAFSTCVSVNNCICHFSPIASEPDYILKKGDLAKIDLGAHIDGFIAVVAHTVVVGE 243 G S C SVN C+CH P + + L+ GD+ ID+ ++DG+ + T GE Sbjct: 184 GFPKSVCTSVNECMCHGIPDSRQ----LQSGDIINIDVTVYLDGYHGDTSRTFFCGE 236 >At1g13270.1 68414.m01541 metallopeptidase M24 family protein similar to SP|Q01662 Methionine aminopeptidase 1 precursor (EC 3.4.11.18) {Saccharomyces cerevisiae}; contains Pfam profile PF00557: metallopeptidase family M24 Length = 369 Score = 41.9 bits (94), Expect = 2e-04 Identities = 20/57 (35%), Positives = 30/57 (52%) Frame = +1 Query: 73 GIAFSTCVSVNNCICHFSPIASEPDYILKKGDLAKIDLGAHIDGFIAVVAHTVVVGE 243 G S C SVN C+CH P + + L+ GD+ ID+ ++DG+ + T GE Sbjct: 184 GFPKSVCTSVNECMCHGIPDSRQ----LQSGDIINIDVTVYLDGYHGDTSRTFFCGE 236 >At4g37040.1 68417.m05246 metallopeptidase M24 family protein similar to SP|O33343 Methionine aminopeptidase (EC 3.4.11.18) (Peptidase M) {Mycobacterium tuberculosis}; contains Pfam profile PF00557: metallopeptidase family M24 Length = 350 Score = 38.3 bits (85), Expect = 0.002 Identities = 21/56 (37%), Positives = 29/56 (51%) Frame = +1 Query: 73 GIAFSTCVSVNNCICHFSPIASEPDYILKKGDLAKIDLGAHIDGFIAVVAHTVVVG 240 G S C SVN CICH P S P L+ GD+ ID+ +++G+ + T G Sbjct: 165 GFPKSVCTSVNECICHGIP-DSRP---LEDGDIINIDVTVYLNGYHGDTSATFFCG 216 >At3g25740.1 68416.m03205 metallopeptidase M24 family protein similar to SP|O33343 Methionine aminopeptidase (EC 3.4.11.18) (Peptidase M) {Mycobacterium tuberculosis}; contains Pfam profile PF00557: metallopeptidase family M24 Length = 344 Score = 37.9 bits (84), Expect = 0.002 Identities = 20/57 (35%), Positives = 30/57 (52%) Frame = +1 Query: 73 GIAFSTCVSVNNCICHFSPIASEPDYILKKGDLAKIDLGAHIDGFIAVVAHTVVVGE 243 G S C SVN C+ H P S P L+ GD+ ID+ ++DG+ + T + G+ Sbjct: 157 GFPKSVCTSVNECMFHGIP-DSRP---LQNGDIINIDVAVYLDGYHGDTSKTFLCGD 209 >At2g45240.1 68415.m05632 methionyl aminopeptidase, putative / methionine aminopeptidase, putative / peptidase M, putative similar to SP|Q01662 Methionine aminopeptidase 1 precursor (EC 3.4.11.18) {Saccharomyces cerevisiae}; contains Pfam profile PF00557: metallopeptidase family M24 Length = 398 Score = 29.5 bits (63), Expect = 0.86 Identities = 18/52 (34%), Positives = 24/52 (46%) Frame = +1 Query: 85 STCVSVNNCICHFSPIASEPDYILKKGDLAKIDLGAHIDGFIAVVAHTVVVG 240 S C SVN ICH P A + L+ GD+ +D+ G + T VG Sbjct: 203 SCCTSVNEVICHGIPDARK----LEDGDIVNVDVTVCYKGCHGDLNETYFVG 250 >At4g29490.1 68417.m04208 Xaa-Pro dipeptidase, putative / prolidase, putative / imidodipeptidase, putative similar to SP|P12955 Xaa-Pro dipeptidase (EC 3.4.13.9) (X-Pro dipeptidase) (Proline dipeptidase) (Prolidase) (Imidodipeptidase) {Homo sapiens}; contains Pfam profiles PF00557: metallopeptidase family M24, PF05195: Aminopeptidase P, N-terminal domain Length = 333 Score = 28.7 bits (61), Expect = 1.5 Identities = 13/38 (34%), Positives = 21/38 (55%), Gaps = 3/38 (7%) Frame = +1 Query: 88 TCVSV---NNCICHFSPIASEPDYILKKGDLAKIDLGA 192 TC+ N+ + H+ A+ D + GDLA +D+GA Sbjct: 240 TCICATGDNSAVLHYGHAAAPNDRTFEDGDLALLDMGA 277 >At1g09300.1 68414.m01041 metallopeptidase M24 family protein similar to SP|P15034 Xaa-Pro aminopeptidase (EC 3.4.11.9) (X-Pro aminopeptidase) (Aminopeptidase P II) (Aminoacylproline aminopeptidase) {Escherichia coli}; contains Pfam profiles PF00557: metallopeptidase family M24, PF05195: Aminopeptidase P, N-terminal domain Length = 493 Score = 26.6 bits (56), Expect = 6.1 Identities = 10/31 (32%), Positives = 18/31 (58%) Frame = +1 Query: 136 SEPDYILKKGDLAKIDLGAHIDGFIAVVAHT 228 S D +K GDL +D+G + G+++ + T Sbjct: 281 SRNDQRIKDGDLVLMDMGCELHGYVSDLTRT 311 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,818,050 Number of Sequences: 28952 Number of extensions: 139149 Number of successful extensions: 387 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 374 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 379 length of database: 12,070,560 effective HSP length: 74 effective length of database: 9,928,112 effective search space used: 575830496 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -