Bombyx BLAST Result against human

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0149.Seq
         (548 letters)

Database: human 
           237,096 sequences; 76,859,062 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

BC101333-1|AAI01334.1|  552|Homo sapiens zinc finger protein 404...    30   6.1  

>BC101333-1|AAI01334.1|  552|Homo sapiens zinc finger protein 404
           protein.
          Length = 552

 Score = 29.9 bits (64), Expect = 6.1
 Identities = 18/64 (28%), Positives = 28/64 (43%)
 Frame = -3

Query: 396 RFLLQKLVHRYMARYECTFFVLSFRPRRRIQFRHKHLQQHNDFEKNRKPFHLNVMAKRTF 217
           + +  +++H  M  YEC     +FR       RH HL +H       KPF      + TF
Sbjct: 201 QLIQHQIIHTGMKPYECKQCGKAFR-------RHSHLTEHQKIHVGLKPFECKECGE-TF 252

Query: 216 AVFR 205
            ++R
Sbjct: 253 RLYR 256


  Database: human
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 76,859,062
  Number of sequences in database:  237,096
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 83,988,357
Number of Sequences: 237096
Number of extensions: 1814035
Number of successful extensions: 3985
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 3719
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 3983
length of database: 76,859,062
effective HSP length: 86
effective length of database: 56,468,806
effective search space used: 5421005376
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)