BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0148.Seq (497 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. 22 4.1 DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated... 21 7.1 >AB207270-1|BAE72137.1| 429|Apis mellifera broad-complex protein. Length = 429 Score = 21.8 bits (44), Expect = 4.1 Identities = 10/27 (37%), Positives = 13/27 (48%) Frame = -1 Query: 281 ASKKLHNLHSNITAPYMRYVCVRDNKT 201 A + H LH N+ P + Y C KT Sbjct: 354 AMRLSHPLHGNLLPPGVCYTCDVCGKT 380 >DQ667193-1|ABG75745.1| 510|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 510 Score = 21.0 bits (42), Expect = 7.1 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +3 Query: 192 TKLRLIITHTHISHIRCSNVTMQIM*FFRSVEKFNLPT 305 T ++++T ++ I N+TM + + E LPT Sbjct: 18 TSSKVMLTRGTVNDIVSRNITMVLENLLMNYENNQLPT 55 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 113,133 Number of Sequences: 438 Number of extensions: 2298 Number of successful extensions: 2 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of database: 146,343 effective HSP length: 54 effective length of database: 122,691 effective search space used: 13618701 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -