BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0146.Seq (499 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC323.01c |||mitochondrial NADH kinase |Schizosaccharomyces po... 25 8.4 SPBC947.05c |||ferric-chelate reductase |Schizosaccharomyces pom... 25 8.4 SPCC622.02 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual 25 8.4 >SPAC323.01c |||mitochondrial NADH kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 361 Score = 24.6 bits (51), Expect = 8.4 Identities = 10/34 (29%), Positives = 20/34 (58%) Frame = +1 Query: 328 KVLR*SLYFINEIHNN*SISQHLSKFRRFPQTRF 429 K+ S+Y +NE+H + +S H++ + F +F Sbjct: 198 KLYNESIYAMNEMHIHRGLSPHMAVLKVFVNDKF 231 >SPBC947.05c |||ferric-chelate reductase |Schizosaccharomyces pombe|chr 2|||Manual Length = 564 Score = 24.6 bits (51), Expect = 8.4 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = -3 Query: 344 LYLKTLRSLLASLRIVFCYLFLTFIKITPVLVSFLVQFHH 225 L+L T+ SL S+R F F VL+ FL+ HH Sbjct: 195 LFLMTVASL-PSVRRKFFEWFFVLHHTCSVLIIFLIWLHH 233 >SPCC622.02 |||dubious|Schizosaccharomyces pombe|chr 3|||Manual Length = 127 Score = 24.6 bits (51), Expect = 8.4 Identities = 13/32 (40%), Positives = 17/32 (53%) Frame = -3 Query: 362 SLMKYKLYLKTLRSLLASLRIVFCYLFLTFIK 267 SL K++ L L S A L I F Y + FI+ Sbjct: 32 SLNKFQYTLPLLISNFAGLGIAFIYCLIAFIR 63 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,806,419 Number of Sequences: 5004 Number of extensions: 32928 Number of successful extensions: 69 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 69 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 69 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 196153982 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -