BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0146.Seq (499 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0065 - 11073816-11074384,11074605-11075160 29 2.7 04_04_0632 + 26738969-26739350,26739535-26739543,26739674-267405... 27 8.4 >06_02_0065 - 11073816-11074384,11074605-11075160 Length = 374 Score = 28.7 bits (61), Expect = 2.7 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 113 TTFLYLDKYSAIHAHSQRPAIYVYTHTLSRII 208 TT L + SA+ H Q+P+ + HTL +I Sbjct: 85 TTHLKQQQQSAVSRHEQKPSFLITPHTLDSMI 116 >04_04_0632 + 26738969-26739350,26739535-26739543,26739674-26740545, 26743048-26743098,26743966-26744127,26744278-26744519, 26744772-26744859,26744964-26745158 Length = 666 Score = 27.1 bits (57), Expect = 8.4 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +2 Query: 203 IIIFIMNDDEIEREKKLKQELFL*RLGINNRIQSAVTQVTIVRF*GK 343 +IIFI+N +E + EK + + + L +N +Q V +V +R GK Sbjct: 424 MIIFILNANENKGEKSIPRTVMLDTKTGSNLLQWPVVEVENLRMRGK 470 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 10,072,320 Number of Sequences: 37544 Number of extensions: 160768 Number of successful extensions: 288 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 287 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 288 length of database: 14,793,348 effective HSP length: 77 effective length of database: 11,902,460 effective search space used: 1047416480 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -