BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0146.Seq (499 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_380| Best HMM Match : AAA (HMM E-Value=0.14) 29 2.8 SB_37006| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-22) 28 3.7 >SB_380| Best HMM Match : AAA (HMM E-Value=0.14) Length = 508 Score = 28.7 bits (61), Expect = 2.8 Identities = 11/23 (47%), Positives = 16/23 (69%) Frame = -3 Query: 308 LRIVFCYLFLTFIKITPVLVSFL 240 L ++FC + LT+ +ITPV FL Sbjct: 365 LTVIFCIIELTYTRITPVQCCFL 387 >SB_37006| Best HMM Match : 7tm_1 (HMM E-Value=1.4e-22) Length = 407 Score = 28.3 bits (60), Expect = 3.7 Identities = 12/32 (37%), Positives = 21/32 (65%) Frame = +2 Query: 116 TFLYLDKYSAIHAHSQRPAIYVYTHTLSRIII 211 T + LD+Y A+H H + PA+ V T + +++I Sbjct: 170 TLISLDRYLALHLHLRYPAV-VTTERILKVLI 200 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,788,545 Number of Sequences: 59808 Number of extensions: 220524 Number of successful extensions: 489 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 378 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 488 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1075029208 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -