BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0146.Seq (499 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U70850-4|AAB09125.3| 483|Caenorhabditis elegans Amino acid tran... 30 1.1 AL117202-2|CAB55092.1| 302|Caenorhabditis elegans Hypothetical ... 27 10.0 >U70850-4|AAB09125.3| 483|Caenorhabditis elegans Amino acid transporter protein 8 protein. Length = 483 Score = 29.9 bits (64), Expect = 1.1 Identities = 12/32 (37%), Positives = 18/32 (56%) Frame = +2 Query: 137 YSAIHAHSQRPAIYVYTHTLSRIIIFIMNDDE 232 +S IH + P + V+ HTL+ II M D + Sbjct: 331 FSLIHVDNDSPRVSVFFHTLTSIIFAFMGDTD 362 >AL117202-2|CAB55092.1| 302|Caenorhabditis elegans Hypothetical protein Y47D3A.2 protein. Length = 302 Score = 26.6 bits (56), Expect = 10.0 Identities = 11/34 (32%), Positives = 17/34 (50%) Frame = -3 Query: 320 LLASLRIVFCYLFLTFIKITPVLVSFLVQFHHHS 219 L+ S + CY+ L F+ I + F F +HS Sbjct: 236 LVKSSNFLHCYIHLPFLNIQEIATIFKPDFSNHS 269 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,667,129 Number of Sequences: 27780 Number of extensions: 174254 Number of successful extensions: 353 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 353 length of database: 12,740,198 effective HSP length: 76 effective length of database: 10,628,918 effective search space used: 945973702 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -