BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0145.Seq (398 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0242 + 42234217-42234320,42234708-42235029,42235377-422357... 27 5.5 01_03_0263 + 14397549-14412911,14413023-14413787,14413950-14414132 26 9.5 >01_07_0242 + 42234217-42234320,42234708-42235029,42235377-42235778, 42235921-42236265,42236785-42236854,42237098-42237173, 42237309-42237459 Length = 489 Score = 27.1 bits (57), Expect = 5.5 Identities = 17/51 (33%), Positives = 27/51 (52%), Gaps = 6/51 (11%) Frame = -1 Query: 356 LXAXYR*AFPL-ISCKFNSSSTVVYKX-----IXLLNSRHDTHTHFRNNNV 222 L + YR A P KF + TVV + + +++S HDTHT ++N+ Sbjct: 413 LWSPYRLAHPHGQKAKFGACKTVVKRIKSGFDVIIMSSSHDTHTSLIDHNI 463 >01_03_0263 + 14397549-14412911,14413023-14413787,14413950-14414132 Length = 5436 Score = 26.2 bits (55), Expect = 9.5 Identities = 14/40 (35%), Positives = 23/40 (57%), Gaps = 1/40 (2%) Frame = -1 Query: 266 NSRHDTHTHFRNNNVYELSNDNRAAVQXF-FDE*LLTAIT 150 N+R +T H ++NN +E +N R V+ D L+T +T Sbjct: 3609 NNRSNTLEHGKDNNTFEHTNSIRGEVEWLEKDNNLVTLLT 3648 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 7,000,755 Number of Sequences: 37544 Number of extensions: 100817 Number of successful extensions: 108 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 105 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 108 length of database: 14,793,348 effective HSP length: 75 effective length of database: 11,977,548 effective search space used: 682720236 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -