BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0142.Seq (618 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 27 0.13 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 27 0.13 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 23 2.7 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 23 2.7 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 23 2.7 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 23 2.7 AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain tran... 23 2.7 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 2.7 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 23 2.7 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 23 2.7 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 23 2.7 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 23 2.7 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 23 2.7 AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia or... 23 2.7 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 22 3.6 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 22 3.6 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 22 4.7 DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulati... 21 6.3 DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase rever... 21 8.3 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 27.1 bits (57), Expect = 0.13 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -1 Query: 270 REAVTWACGHHRVPRETSRLLRHCAHQGLHGTHLRHEV 157 RE +TW H R +R R C H GT +R + Sbjct: 593 REQLTWRRNFHGPHRLAARSRRCCYHAVAPGTDIRQSI 630 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 27.1 bits (57), Expect = 0.13 Identities = 13/38 (34%), Positives = 17/38 (44%) Frame = -1 Query: 270 REAVTWACGHHRVPRETSRLLRHCAHQGLHGTHLRHEV 157 RE +TW H R +R R C H GT +R + Sbjct: 485 REQLTWRRNFHGPHRLAARSRRCCYHAVAPGTDIRQSI 522 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 237 DGAHTPKLRPP 269 DGA TP +RPP Sbjct: 65 DGASTPDVRPP 75 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.7 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = -3 Query: 487 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 323 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.7 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = -3 Query: 487 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 323 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 22.6 bits (46), Expect = 2.7 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = -3 Query: 487 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 323 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AY043293-1|AAK96033.1| 523|Tribolium castaneum homeodomain transcription factor Maxillopediaprotein. Length = 523 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = -1 Query: 192 QGLHGTHLRHEVEQRVHNRQGHEGVHLAAARQGHPP 85 QG G H + ++ G E HL GH P Sbjct: 379 QGYQGEHPNYNHYGYHYSGDGGEVAHLPNTHMGHEP 414 Score = 21.0 bits (42), Expect = 8.3 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -2 Query: 368 PTYQSQRFHPVRHRNYEDYGLHQ 300 P Q Q ++ H N E+Y HQ Sbjct: 353 PNPQQQYYYNKNHPNSENYINHQ 375 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 22.6 bits (46), Expect = 2.7 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 237 DGAHTPKLRPP 269 DGA TP +RPP Sbjct: 221 DGASTPDVRPP 231 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 22.6 bits (46), Expect = 2.7 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = -3 Query: 487 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 323 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 22.6 bits (46), Expect = 2.7 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = -3 Query: 487 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 323 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 22.6 bits (46), Expect = 2.7 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = -3 Query: 487 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 323 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 20 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 74 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 22.6 bits (46), Expect = 2.7 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = -3 Query: 487 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 323 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 22.6 bits (46), Expect = 2.7 Identities = 12/55 (21%), Positives = 22/55 (40%) Frame = -3 Query: 487 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 323 H + P Y + +R+A+ P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLASTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >AF187069-1|AAF03889.1| 471|Tribolium castaneum proboscipedia ortholog protein. Length = 471 Score = 22.6 bits (46), Expect = 2.7 Identities = 11/36 (30%), Positives = 14/36 (38%) Frame = -1 Query: 192 QGLHGTHLRHEVEQRVHNRQGHEGVHLAAARQGHPP 85 QG G H + ++ G E HL GH P Sbjct: 327 QGYQGEHPNYNHYGYHYSGDGGEVAHLPNTHMGHEP 362 Score = 21.0 bits (42), Expect = 8.3 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = -2 Query: 368 PTYQSQRFHPVRHRNYEDYGLHQ 300 P Q Q ++ H N E+Y HQ Sbjct: 301 PNPQQQYYYNKNHPNSENYINHQ 323 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 22.2 bits (45), Expect = 3.6 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +3 Query: 273 IIHKFPDSNLMKSIIFVVAMSNWMESL 353 II +F L + VV +SNW E L Sbjct: 239 IIARFNIERLCNGLKRVVKLSNWREPL 265 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 22.2 bits (45), Expect = 3.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = -1 Query: 102 RQGHPPHHRRG 70 RQG PPHH G Sbjct: 57 RQGIPPHHYGG 67 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.8 bits (44), Expect = 4.7 Identities = 12/55 (21%), Positives = 21/55 (38%) Frame = -3 Query: 487 HRITPEEAKYKLCKVKRVATGPKNVPYLVTHDGRTIRYPDPLIKVNDSIQLDIAT 323 H + P Y + +R+A P TH + +Y D + D++T Sbjct: 64 HGLQPTMGDYTQLQPQRLAPTHLQSPNTQTHPSASCKYADSTSSTGVASPQDLST 118 >DQ490059-1|ABF22614.1| 947|Tribolium castaneum short gastrulation protein. Length = 947 Score = 21.4 bits (43), Expect = 6.3 Identities = 8/19 (42%), Positives = 12/19 (63%) Frame = -3 Query: 538 TNELFSSNL*VKGRFTIHR 482 +N L +N+ GRFT H+ Sbjct: 158 SNNLNKNNVVATGRFTFHK 176 >DQ372925-1|ABD17350.1| 596|Tribolium castaneum telomerase reverse transcriptase protein. Length = 596 Score = 21.0 bits (42), Expect = 8.3 Identities = 7/21 (33%), Positives = 13/21 (61%) Frame = -1 Query: 471 RRLSTSCVKSSVWRPDLRMFR 409 R+++ C+KS WR L + + Sbjct: 525 RKVTFQCLKSIAWRAFLAVLK 545 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,470 Number of Sequences: 336 Number of extensions: 3414 Number of successful extensions: 22 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 122,585 effective HSP length: 54 effective length of database: 104,441 effective search space used: 15770591 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -