BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0141.Seq (449 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 4.7 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 21 6.2 DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. 21 6.2 AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex det... 21 6.2 AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex det... 21 6.2 AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex det... 21 6.2 AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex det... 21 6.2 AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex det... 21 6.2 AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex det... 21 6.2 AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex det... 21 6.2 AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex det... 21 6.2 AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex det... 21 6.2 AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex det... 21 6.2 AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex det... 21 6.2 AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex det... 21 6.2 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 6.2 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 21 8.2 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 21 8.2 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 4.7 Identities = 11/27 (40%), Positives = 11/27 (40%) Frame = -1 Query: 386 KGNQGTHNRIDRKELEVLAANCERTAE 306 K N H RI KE CER E Sbjct: 132 KENLSVHRRIHTKERPYKCDVCERAFE 158 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.0 bits (42), Expect = 6.2 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 303 RRSLKDYSTYIKSH 262 R SL++Y T I SH Sbjct: 45 RSSLRNYKTLISSH 58 >DQ011226-1|AAY63895.1| 471|Apis mellifera Rh-like protein protein. Length = 471 Score = 21.0 bits (42), Expect = 6.2 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = -1 Query: 110 YWPFINVNSVNCSSYSFMYVYYYLFF 33 Y P NVN + + +M+ Y +L + Sbjct: 30 YGPEANVNLLKNRTGRYMFTYLHLLY 55 >AY569721-1|AAS86674.1| 400|Apis mellifera complementary sex determiner protein. Length = 400 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 180 IKKLGNR*NDFKTKRRSLRS 121 IKK GN + T SLRS Sbjct: 189 IKKSGNESKKYATSSNSLRS 208 >AY569717-1|AAS86670.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 180 IKKLGNR*NDFKTKRRSLRS 121 IKK GN + T SLRS Sbjct: 189 IKKSGNESKKYATSSNSLRS 208 >AY569716-1|AAS86669.1| 406|Apis mellifera complementary sex determiner protein. Length = 406 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 180 IKKLGNR*NDFKTKRRSLRS 121 IKK GN + T SLRS Sbjct: 200 IKKSGNESKKYATSSNSLRS 219 >AY569712-1|AAS86665.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 180 IKKLGNR*NDFKTKRRSLRS 121 IKK GN + T SLRS Sbjct: 200 IKKSGNESKKYATSSNSLRS 219 >AY569710-1|AAS86663.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 180 IKKLGNR*NDFKTKRRSLRS 121 IKK GN + T SLRS Sbjct: 200 IKKSGNESKKYATSSNSLRS 219 >AY569709-1|AAS86662.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 180 IKKLGNR*NDFKTKRRSLRS 121 IKK GN + T SLRS Sbjct: 200 IKKSGNESKKYATSSNSLRS 219 >AY569708-1|AAS86661.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 180 IKKLGNR*NDFKTKRRSLRS 121 IKK GN + T SLRS Sbjct: 200 IKKSGNESKKYATSSNSLRS 219 >AY569707-1|AAS86660.1| 408|Apis mellifera complementary sex determiner protein. Length = 408 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 180 IKKLGNR*NDFKTKRRSLRS 121 IKK GN + T SLRS Sbjct: 200 IKKSGNESKKYATSSNSLRS 219 >AY569706-1|AAS86659.1| 397|Apis mellifera complementary sex determiner protein. Length = 397 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 180 IKKLGNR*NDFKTKRRSLRS 121 IKK GN + T SLRS Sbjct: 189 IKKSGNESKKYATSSNSLRS 208 >AY569705-1|AAS86658.1| 419|Apis mellifera complementary sex determiner protein. Length = 419 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 180 IKKLGNR*NDFKTKRRSLRS 121 IKK GN + T SLRS Sbjct: 200 IKKSGNESKKYATSSNSLRS 219 >AY569704-1|AAS86657.1| 426|Apis mellifera complementary sex determiner protein. Length = 426 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 180 IKKLGNR*NDFKTKRRSLRS 121 IKK GN + T SLRS Sbjct: 200 IKKSGNESKKYATSSNSLRS 219 >AY569698-1|AAS86651.1| 407|Apis mellifera complementary sex determiner protein. Length = 407 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 180 IKKLGNR*NDFKTKRRSLRS 121 IKK GN + T SLRS Sbjct: 200 IKKSGNESKKYATSSNSLRS 219 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.0 bits (42), Expect = 6.2 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = -3 Query: 180 IKKLGNR*NDFKTKRRSLRS 121 IKK GN + T SLRS Sbjct: 200 IKKSGNESKKYATSSNSLRS 219 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 20.6 bits (41), Expect = 8.2 Identities = 11/35 (31%), Positives = 18/35 (51%) Frame = -1 Query: 149 LRRNVAHSALNS*YWPFINVNSVNCSSYSFMYVYY 45 L +N+ +SAL+S ++N S Y V+Y Sbjct: 259 LTQNLYYSALSSHNLNYVNTEQFVKSQYQANNVHY 293 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 20.6 bits (41), Expect = 8.2 Identities = 9/14 (64%), Positives = 9/14 (64%) Frame = +3 Query: 105 PISTVQSGVSDVSS 146 P S SGVSDV S Sbjct: 242 PASPADSGVSDVES 255 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 102,080 Number of Sequences: 438 Number of extensions: 1652 Number of successful extensions: 18 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 11820384 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -