BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0139.Seq (648 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 09_04_0256 + 16148820-16148998,16149547-16150241,16150317-161505... 28 5.6 07_03_1652 - 28409097-28409165,28409788-28409911,28410317-284105... 28 5.6 07_03_0014 - 12428713-12428860,12429340-12429580,12429664-124303... 28 5.6 05_05_0338 + 24204301-24206262,24206337-24206495,24206864-242070... 28 5.6 05_01_0595 + 5344721-5345249,5349183-5349264,5349813-5350507,535... 28 5.6 03_03_0039 - 13986844-13986907,13987219-13987273,13987492-139876... 28 5.6 02_05_1149 + 34471730-34471790,34471975-34472056,34472605-344732... 28 5.6 01_05_0117 - 18300157-18301106,18301149-18301543,18302592-183026... 28 5.6 >09_04_0256 + 16148820-16148998,16149547-16150241,16150317-16150573, 16150668-16151349,16151423-16151626,16151715-16152449, 16152533-16152698,16153253-16153400 Length = 1021 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 3 RKFVVMPTLNQSKFDEAKFKGDLEARYVLYCLS 101 ++ + M + S F ++KF G LE RY CLS Sbjct: 492 KRDLFMQWMASSVFMQSKFSGTLEGRYAHACLS 524 >07_03_1652 - 28409097-28409165,28409788-28409911,28410317-28410557, 28410641-28411375,28411464-28411667,28411741-28412422, 28412517-28412773,28412849-28413543,28414003-28414250 Length = 1084 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 3 RKFVVMPTLNQSKFDEAKFKGDLEARYVLYCLS 101 ++ + M + S F ++KF G LE RY CLS Sbjct: 515 KRDLFMQWMASSVFMQSKFSGTLEGRYAHACLS 547 >07_03_0014 - 12428713-12428860,12429340-12429580,12429664-12430398, 12430487-12430690,12430764-12431445,12431540-12431796, 12431872-12432566,12433012-12433172,12434039-12434383, 12434399-12434631,12434656-12434740 Length = 1261 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 3 RKFVVMPTLNQSKFDEAKFKGDLEARYVLYCLS 101 ++ + M + S F ++KF G LE RY CLS Sbjct: 707 KRDLFMQWMASSVFMQSKFSGTLEGRYAHACLS 739 >05_05_0338 + 24204301-24206262,24206337-24206495,24206864-24207035, 24207544-24207842,24208301-24208355,24208438-24208487, 24208522-24208827 Length = 1000 Score = 28.3 bits (60), Expect = 5.6 Identities = 8/19 (42%), Positives = 15/19 (78%) Frame = +2 Query: 296 PIYYRRSNTKPHNYKIISQ 352 P+ + ++NTKPH Y++I + Sbjct: 977 PVEFNKTNTKPHGYELIPE 995 >05_01_0595 + 5344721-5345249,5349183-5349264,5349813-5350507, 5350583-5350839,5350934-5351615,5351689-5351892, 5351981-5352715,5352799-5353181 Length = 1188 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 3 RKFVVMPTLNQSKFDEAKFKGDLEARYVLYCLS 101 ++ + M + S F ++KF G LE RY CLS Sbjct: 636 KRDLFMQWMASSVFMQSKFSGTLEGRYAHACLS 668 >03_03_0039 - 13986844-13986907,13987219-13987273,13987492-13987606, 13987652-13987774,13987962-13988015,13988352-13988411, 13988522-13988584,13988790-13988863,13989177-13989261, 13989376-13989456,13989764-13989856,13990275-13990339, 13990407-13990482,13990570-13990635,13991094-13991153, 13991233-13991322,13991755-13991817,13992502-13992625, 13993031-13993271,13993355-13993624,13993715-13994089, 13994178-13994381,13994455-13995136,13995231-13995279, 13995362-13995488,13995564-13996258,13996718-13996965 Length = 1433 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 3 RKFVVMPTLNQSKFDEAKFKGDLEARYVLYCLS 101 ++ + M + S F ++KF G LE RY CLS Sbjct: 488 KRDLFMQWMASSVFMQSKFSGTLEGRYAHACLS 520 >02_05_1149 + 34471730-34471790,34471975-34472056,34472605-34473299, 34473375-34473631,34473726-34474407,34474481-34474684, 34474773-34474903,34475068-34475263,34475347-34475587, 34476067-34476214 Length = 898 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 3 RKFVVMPTLNQSKFDEAKFKGDLEARYVLYCLS 101 ++ + M + S F ++KF G LE RY CLS Sbjct: 480 KRDLFMQWMASSVFMQSKFSGTLEGRYAHACLS 512 >01_05_0117 - 18300157-18301106,18301149-18301543,18302592-18302681, 18303723-18303836,18303903-18304046,18316147-18316312, 18316396-18317130,18317219-18317422,18317496-18318177, 18318272-18318528,18318604-18319298,18319345-18319382, 18319847-18319928,18320018-18320112,18320443-18320526, 18320601-18320891,18321521-18321853,18321948-18322150, 18322243-18322399,18322482-18322585,18322675-18322835, 18323511-18323824,18324317-18324589,18324666-18324967, 18325459-18325549,18326140-18326190,18326700-18326768, 18326926-18327017,18327082-18327148,18328582-18328746, 18329027-18329103,18329572-18329766,18330208-18330275, 18331081-18331172,18331399-18331522,18331608-18331705, 18332384-18332997,18333620-18333626 Length = 2892 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/33 (39%), Positives = 19/33 (57%) Frame = +3 Query: 3 RKFVVMPTLNQSKFDEAKFKGDLEARYVLYCLS 101 ++ + M + S F ++KF G LE RY CLS Sbjct: 1848 KRDLFMQWMASSVFMQSKFSGTLEGRYAHACLS 1880 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,600,243 Number of Sequences: 37544 Number of extensions: 168838 Number of successful extensions: 300 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 296 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 300 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -