BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0137.Seq (499 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_UPI0000F2CA36 Cluster: PREDICTED: hypothetical protein;... 33 4.7 UniRef50_A0BU14 Cluster: Chromosome undetermined scaffold_128, w... 33 4.7 >UniRef50_UPI0000F2CA36 Cluster: PREDICTED: hypothetical protein; n=1; Monodelphis domestica|Rep: PREDICTED: hypothetical protein - Monodelphis domestica Length = 391 Score = 32.7 bits (71), Expect = 4.7 Identities = 18/67 (26%), Positives = 29/67 (43%) Frame = +1 Query: 121 LSRLQIY*FRFLYFTVAIYSKQIN*KVXSALYYLRHLNMKFKTLHYMXPFTILLTFLSIA 300 ++RL ++ ++ LY T YS +N + Y+ L M + LH + IL Sbjct: 277 ITRLIVFPYKVLYSTY--YSSMVNHEPFFGYYFTNGLLMILQALHVFWSYLILCMLFRYV 334 Query: 301 NCSVFAK 321 NC K Sbjct: 335 NCGTMEK 341 >UniRef50_A0BU14 Cluster: Chromosome undetermined scaffold_128, whole genome shotgun sequence; n=8; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_128, whole genome shotgun sequence - Paramecium tetraurelia Length = 2907 Score = 32.7 bits (71), Expect = 4.7 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = -2 Query: 435 RVRIYSSNLNXKFICNLXNQYCTFQARNTRDTLIQYLRLXKYRAICN 295 ++RIY+ N + + NL N YC Q N + Q L L K + N Sbjct: 2242 QMRIYAVNSQLEIVRNLTNTYCELQINNLNSSQQQNLSLNKNKIYFN 2288 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 333,891,043 Number of Sequences: 1657284 Number of extensions: 4901227 Number of successful extensions: 8414 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 8239 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8413 length of database: 575,637,011 effective HSP length: 95 effective length of database: 418,195,031 effective search space used: 29273652170 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -