BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= msgV0136.Seq
(598 letters)
Database: nematostella
59,808 sequences; 16,821,457 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SB_47862| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.8
>SB_47862| Best HMM Match : No HMM Matches (HMM E-Value=.)
Length = 454
Score = 28.7 bits (61), Expect = 3.8
Identities = 17/61 (27%), Positives = 29/61 (47%)
Frame = -1
Query: 208 YILVALLVVGNTAAIDFYIFCIYVAQWDSGSRVSDKNVS*AIVSIFILL*NCHKTILLYL 29
+++V L+ I F I + AQW GS S +S A+ + + N + L+YL
Sbjct: 359 FLMVITLLCAALTVIFFVISNVNEAQWKFGSEESTVEISSALFTGIYGMWNTYVLTLMYL 418
Query: 28 F 26
+
Sbjct: 419 Y 419
Database: nematostella
Posted date: Oct 22, 2007 1:22 PM
Number of letters in database: 16,821,457
Number of sequences in database: 59,808
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 16,802,765
Number of Sequences: 59808
Number of extensions: 321632
Number of successful extensions: 645
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 569
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 643
length of database: 16,821,457
effective HSP length: 79
effective length of database: 12,096,625
effective search space used: 1439498375
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -