BLASTX 2.2.12 [Aug-07-2005]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Query= msgV0134.Seq
(499 letters)
Database: nematostella
59,808 sequences; 16,821,457 total letters
Searching..................................................done
Score E
Sequences producing significant alignments: (bits) Value
SB_22017| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-08) 30 0.92
>SB_22017| Best HMM Match : 7tm_1 (HMM E-Value=1.8e-08)
Length = 338
Score = 30.3 bits (65), Expect = 0.92
Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
Frame = -2
Query: 204 RFAYFIKLYTSMLHEQI*FKFSTMSFNFSLCFYI*LNKAI*TVYTCNVNY-PCFCFNSVF 28
R A+ +L ++ LHE++ +K +S L FY+ + V C +N P C N F
Sbjct: 242 RRAWMRRLTSNSLHERVNYKVFKISLAIVLAFYLCYSCYWLQVTLCTLNEPPRLCANQTF 301
Query: 27 YF 22
F
Sbjct: 302 RF 303
Database: nematostella
Posted date: Oct 22, 2007 1:22 PM
Number of letters in database: 16,821,457
Number of sequences in database: 59,808
Lambda K H
0.318 0.134 0.401
Gapped
Lambda K H
0.279 0.0580 0.190
Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 9,470,085
Number of Sequences: 59808
Number of extensions: 135415
Number of successful extensions: 385
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 371
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 385
length of database: 16,821,457
effective HSP length: 77
effective length of database: 12,216,241
effective search space used: 1075029208
frameshift window, decay const: 40, 0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)
- SilkBase 1999-2023 -