BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0130.Seq (598 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC1826.01c |mot1||TATA-binding protein associated factor Mot1|... 27 1.6 SPBC56F2.08c |||RNA-binding protein|Schizosaccharomyces pombe|ch... 27 2.7 SPAC22H10.02 |||conserved fungal protein|Schizosaccharomyces pom... 26 3.6 SPBP35G2.09 |usp103|yhc1|U1 snRNP-associated protein Usp103 |Sch... 26 3.6 SPAP7G5.03 |||conjugation protein |Schizosaccharomyces pombe|chr... 26 4.8 SPAC14C4.15c ||SPAPJ760.01c|dipeptidyl aminopeptidase |Schizosac... 25 8.4 SPAC1B1.01 |||transcription factor Rdp1|Schizosaccharomyces pomb... 25 8.4 >SPBC1826.01c |mot1||TATA-binding protein associated factor Mot1|Schizosaccharomyces pombe|chr 2|||Manual Length = 1953 Score = 27.5 bits (58), Expect = 1.6 Identities = 10/21 (47%), Positives = 14/21 (66%) Frame = -2 Query: 342 CRRFANIPRHNYVYLASILYI 280 C +FA +PR NY L S L++ Sbjct: 860 CDQFATVPRENYANLVSQLHV 880 >SPBC56F2.08c |||RNA-binding protein|Schizosaccharomyces pombe|chr 2|||Manual Length = 661 Score = 26.6 bits (56), Expect = 2.7 Identities = 17/56 (30%), Positives = 30/56 (53%), Gaps = 3/56 (5%) Frame = +2 Query: 71 EDQNVNFG--LI*TINVFLNT-INASRTSAPLLLPWSLNLF*FRHRHSLLQFERQT 229 E++N F + ++ +N+ + A+ ++ LLL W L+ FR+RH LL T Sbjct: 322 ENENATFEQQALVVASIIINSHLLATNSNGMLLLTWLLDNSFFRNRHRLLAIHLAT 377 >SPAC22H10.02 |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 158 Score = 26.2 bits (55), Expect = 3.6 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = -2 Query: 378 PVKGLYSEVGSRCRRFANIP 319 P+ GL+ VGSR R+ + IP Sbjct: 114 PLSGLHQNVGSRTRKSSGIP 133 >SPBP35G2.09 |usp103|yhc1|U1 snRNP-associated protein Usp103 |Schizosaccharomyces pombe|chr 2|||Manual Length = 182 Score = 26.2 bits (55), Expect = 3.6 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = -1 Query: 397 APESTRSSKRTLLRGRESVPPIREHPAAQ 311 AP++T SS L + ++S+P EH A+ Sbjct: 128 APQTTASSNTQLTQQQQSLPQTNEHQRAR 156 >SPAP7G5.03 |||conjugation protein |Schizosaccharomyces pombe|chr 1|||Manual Length = 703 Score = 25.8 bits (54), Expect = 4.8 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +2 Query: 80 NVNFGLI*TINVFLNTINASRTSA 151 N L T+N F+N +N+S TSA Sbjct: 453 NTTLSLNSTLNTFMNELNSSMTSA 476 >SPAC14C4.15c ||SPAPJ760.01c|dipeptidyl aminopeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 853 Score = 25.0 bits (52), Expect = 8.4 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = -2 Query: 360 SEVGSRCRRFANIPRHNYVYLASILYISPF*LFCKIILVF 241 SE+ ++ RR +H Y+YLA L+ L C II F Sbjct: 52 SEIEAKKRRRK---KHRYIYLAVCLFFLASVLSCAIIFRF 88 >SPAC1B1.01 |||transcription factor Rdp1|Schizosaccharomyces pombe|chr 1|||Manual Length = 478 Score = 25.0 bits (52), Expect = 8.4 Identities = 17/46 (36%), Positives = 23/46 (50%), Gaps = 1/46 (2%) Frame = +1 Query: 427 FISSGPNSLT*VTSRPSXAF*SDYTLRTQP-EPSFKRREVHVPGGT 561 F +GPN+ T+ PS S +L+ QP PS+ R P GT Sbjct: 348 FAQNGPNTSLLPTAMPSDVSISS-SLQQQPIHPSYDSRFSKAPQGT 392 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,229,958 Number of Sequences: 5004 Number of extensions: 40736 Number of successful extensions: 90 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 90 length of database: 2,362,478 effective HSP length: 69 effective length of database: 2,017,202 effective search space used: 260219058 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -