BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0130.Seq (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36) 29 3.8 SB_26242| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.8e-15) 28 5.0 >SB_51590| Best HMM Match : HSP70 (HMM E-Value=4.4e-36) Length = 437 Score = 28.7 bits (61), Expect = 3.8 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 318 AGCSRIGGTDSRPRSRVLLLDLVDSGASHVLSCHHSFHLLRAE 446 AG +R+GG D R LL L+ + L+C LR E Sbjct: 252 AGNNRLGGQDFNARFMQYLLQLIHKRFNRQLTCSEDIQRLRQE 294 >SB_26242| Best HMM Match : Pkinase_Tyr (HMM E-Value=2.8e-15) Length = 1019 Score = 28.3 bits (60), Expect = 5.0 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +2 Query: 161 LPWSLNLF*FRHRHSLLQFER-QTMTDVKTKII 256 LPW+++ FR +HSLL R + DVK K I Sbjct: 275 LPWAISHGKFRDKHSLLHTLRDNSSNDVKEKFI 307 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,997,750 Number of Sequences: 59808 Number of extensions: 311377 Number of successful extensions: 643 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 603 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 643 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -