BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0129.Seq (419 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5196| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_16055| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 2.7 SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 3.6 SB_6424| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.3 >SB_5196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 412 Score = 29.1 bits (62), Expect = 1.6 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = -3 Query: 411 PPQARPGQAQPLQAVLLPRAVQVHRTLPPLXLVFPGVI 298 P +RP A P LP+ V R LP L VFPG++ Sbjct: 318 PSISRPATAPPPVFRGLPQLPPVFRCLPQLPPVFPGLL 355 >SB_16055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 848 Score = 28.3 bits (60), Expect = 2.7 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = -3 Query: 294 QA*TDFYTSLVKENMPLLRKHIRYSLPSP*EYRCLIQLNTTWSIPCSV 151 Q+ +Y VKE + H+ + P RC I+LN WS PC V Sbjct: 738 QSQKSYYDCWVKEKIFKKGDHVLWFDKKPRRGRC-IKLNRPWSGPCIV 784 >SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 392 Score = 27.9 bits (59), Expect = 3.6 Identities = 13/36 (36%), Positives = 19/36 (52%) Frame = -2 Query: 265 GQGKYAFASKTYSIFLTISVRISVFNTTKHDLEYSL 158 G YA+ +++ FLT VFN+T DL+ L Sbjct: 200 GAANYAWVNRSSMTFLTRQAFAKVFNSTPDDLDMHL 235 >SB_6424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 219 Score = 27.1 bits (57), Expect = 6.3 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = -3 Query: 417 PIPPQARPGQAQPLQAVLLPRAVQVHRTLPPLXL 316 P P RPGQAQ L L +HR+L PL L Sbjct: 40 PGPMARRPGQAQTLGT--LVEDAHMHRSLRPLAL 71 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,039,117 Number of Sequences: 59808 Number of extensions: 229707 Number of successful extensions: 365 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 364 length of database: 16,821,457 effective HSP length: 75 effective length of database: 12,335,857 effective search space used: 789494848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -