BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0128.Seq (459 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pomb... 25 5.6 SPCC126.08c |||lectin |Schizosaccharomyces pombe|chr 3|||Manual 25 5.6 SPBC1604.12 |||sequence orphan|Schizosaccharomyces pombe|chr 2||... 25 5.6 SPCC1742.01 ||SPCC1795.13, SPCPB16A4.07c|sequence orphan|Schizos... 25 7.3 >SPAC3H5.09c |||conserved fungal protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 2685 Score = 25.0 bits (52), Expect = 5.6 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = -1 Query: 96 GTQGFNVV*AFSGHDFSNKLLLAARAIR 13 G Q N++ + H+FSN+ LL + IR Sbjct: 2301 GCQFENIICPYFNHEFSNEQLLQQKFIR 2328 >SPCC126.08c |||lectin |Schizosaccharomyces pombe|chr 3|||Manual Length = 312 Score = 25.0 bits (52), Expect = 5.6 Identities = 15/40 (37%), Positives = 19/40 (47%) Frame = -3 Query: 238 IASASYSTFGNGHAFSLRVEEVSRITVAGCDEXRHATGVF 119 I S S S FG+G AF L E V G + + G+F Sbjct: 92 INSESTSLFGDGLAFFLAAERAKPGPVFGFTDKFNGYGIF 131 >SPBC1604.12 |||sequence orphan|Schizosaccharomyces pombe|chr 2|||Manual Length = 860 Score = 25.0 bits (52), Expect = 5.6 Identities = 11/27 (40%), Positives = 14/27 (51%) Frame = +1 Query: 73 HDIEPLRADLCRPGIETHQLRDGFHRN 153 H PLR +C PG +T Q+ RN Sbjct: 810 HPTHPLRVTVCLPGSKTIQVARRSFRN 836 >SPCC1742.01 ||SPCC1795.13, SPCPB16A4.07c|sequence orphan|Schizosaccharomyces pombe|chr 3|||Manual Length = 1563 Score = 24.6 bits (51), Expect = 7.3 Identities = 10/23 (43%), Positives = 14/23 (60%) Frame = +3 Query: 144 SSQPATVILDTSSTRRENACPLP 212 S PATV++ T+S +CP P Sbjct: 169 SCNPATVLIVTTSGSTSTSCPPP 191 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,673,141 Number of Sequences: 5004 Number of extensions: 28690 Number of successful extensions: 62 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 61 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 62 length of database: 2,362,478 effective HSP length: 67 effective length of database: 2,027,210 effective search space used: 172312850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -