BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0128.Seq (459 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0655 - 19621717-19622594,19623186-19623227,19624323-196244... 29 1.4 09_06_0180 - 21385655-21386017,21386399-21386623,21386859-21387305 28 4.2 >10_08_0655 - 19621717-19622594,19623186-19623227,19624323-19624479, 19625333-19625405,19625483-19625595 Length = 420 Score = 29.5 bits (63), Expect = 1.4 Identities = 13/39 (33%), Positives = 19/39 (48%) Frame = +2 Query: 11 SLMALAASKSLFEKSCPENAHTTLNPCVPTCADPELKHT 127 S +AL+ SK + E + PE L C+ P +HT Sbjct: 260 STVALSVSKVMGEDAKPETVSEALTACIEETCSPAYRHT 298 >09_06_0180 - 21385655-21386017,21386399-21386623,21386859-21387305 Length = 344 Score = 27.9 bits (59), Expect = 4.2 Identities = 16/43 (37%), Positives = 21/43 (48%), Gaps = 1/43 (2%) Frame = -3 Query: 211 GNGHAFSLRVEEVSRITVAGCDEXRHATGVFQFR-VCTGRHAG 86 GNG AF + + V R+TV + F VC GRH+G Sbjct: 123 GNGEAFGAQKDGVWRLTVKDLKIGNIEVFLVDFLIVCIGRHSG 165 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,000,243 Number of Sequences: 37544 Number of extensions: 194990 Number of successful extensions: 360 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 353 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 360 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 907440304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -