BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0126.Seq (528 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAPB1E7.06c |eme1||Holliday junction resolvase subunit Eme1|Sch... 26 4.0 >SPAPB1E7.06c |eme1||Holliday junction resolvase subunit Eme1|Schizosaccharomyces pombe|chr 1|||Manual Length = 738 Score = 25.8 bits (54), Expect = 4.0 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = +3 Query: 414 INTAGDVATTHRWLRAXGFQIIISRHFYFSR 506 INT+ D T +W+ + I +SR+ +FS+ Sbjct: 609 INTSNDEKETAQWIVSFTGDIALSRYKHFSK 639 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,567,207 Number of Sequences: 5004 Number of extensions: 22499 Number of successful extensions: 34 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 34 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 34 length of database: 2,362,478 effective HSP length: 68 effective length of database: 2,022,206 effective search space used: 216376042 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -