BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0125.Seq (598 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z54342-2|CAA91144.2| 1220|Caenorhabditis elegans Hypothetical pr... 37 0.009 AL117203-10|CAB60424.2| 855|Caenorhabditis elegans Hypothetical... 28 4.4 Z11505-2|CAA77585.1| 418|Caenorhabditis elegans Hypothetical pr... 27 7.7 >Z54342-2|CAA91144.2| 1220|Caenorhabditis elegans Hypothetical protein C08H9.2 protein. Length = 1220 Score = 37.1 bits (82), Expect = 0.009 Identities = 21/62 (33%), Positives = 33/62 (53%), Gaps = 1/62 (1%) Frame = +2 Query: 326 FHVPYEERKLDNANTFGE-GESLRTCHSITKDTGAHIEISTSKDGSLTXLITGKQSAVLE 502 F + +ER + +FG E + +I T IE+S SKDG LT ++ G+++ E Sbjct: 65 FRLASDERS-NKVKSFGSTSEESKKAQAIATATKTRIELSESKDGELTVVVKGERAKAEE 123 Query: 503 AR 508 AR Sbjct: 124 AR 125 >AL117203-10|CAB60424.2| 855|Caenorhabditis elegans Hypothetical protein Y48C3A.14 protein. Length = 855 Score = 28.3 bits (60), Expect = 4.4 Identities = 15/39 (38%), Positives = 22/39 (56%), Gaps = 2/39 (5%) Frame = -1 Query: 460 TAIFAGRYFDVRSCILSYG--MASS*GFSLTESISIVKF 350 T F G+Y D+ S ++SYG + GF +T IV+F Sbjct: 198 TKFFQGKYGDLDSNVISYGPCQTPTLGFCVTRHDQIVQF 236 >Z11505-2|CAA77585.1| 418|Caenorhabditis elegans Hypothetical protein F59B2.3 protein. Length = 418 Score = 27.5 bits (58), Expect = 7.7 Identities = 19/46 (41%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +2 Query: 311 LHTQVFHVPYEERKLDNAN-TFGEGESLRTC-HSITKDTGAHIEIS 442 L TQ HV E KLD N T G S+ C + K TG IE + Sbjct: 320 LGTQTIHVKGLEAKLDGTNTTAGSVASMPYCIRHLMKATGCPIEFA 365 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,456,407 Number of Sequences: 27780 Number of extensions: 237470 Number of successful extensions: 534 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 517 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 534 length of database: 12,740,198 effective HSP length: 78 effective length of database: 10,573,358 effective search space used: 1268802960 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -