BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0125.Seq (598 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related pro... 22 4.0 AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. 22 5.3 AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein ... 22 5.3 >DQ015969-1|AAY81926.1| 397|Apis mellifera stargazin related protein STG-1 protein. Length = 397 Score = 22.2 bits (45), Expect = 4.0 Identities = 8/20 (40%), Positives = 11/20 (55%) Frame = -1 Query: 142 YHISNHHGLLMHHFCLLRQS 83 YH+ NHH +H +L S Sbjct: 274 YHLDNHHVHHANHHAILGHS 293 >AY686596-1|AAT96374.1| 1946|Apis mellifera Dscam protein. Length = 1946 Score = 21.8 bits (44), Expect = 5.3 Identities = 9/32 (28%), Positives = 16/32 (50%) Frame = -2 Query: 417 SLVMEWQVLKDSPSPKVLALSSFRSSYGTWKT 322 S+ + W D SP + ++ S G+W+T Sbjct: 891 SVQLSWAAPYDGNSPIKRYVIEYKISKGSWET 922 >AJ276511-1|CAC06383.1| 352|Apis mellifera Antennapedia protein protein. Length = 352 Score = 21.8 bits (44), Expect = 5.3 Identities = 7/17 (41%), Positives = 12/17 (70%) Frame = +2 Query: 86 LPEETKMMHQQSMMVGD 136 +P++T+ + QQS GD Sbjct: 34 VPQQTQSVQQQSQQAGD 50 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 149,912 Number of Sequences: 438 Number of extensions: 2952 Number of successful extensions: 4 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 55 effective length of database: 122,253 effective search space used: 17482179 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -