BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0124.Seq (548 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to S... 166 1e-41 At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 A... 166 1e-41 At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496... 166 1e-41 At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 A... 166 1e-41 At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 A... 161 3e-40 At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 A... 161 3e-40 At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 A... 161 4e-40 At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497... 161 4e-40 At2g42100.1 68415.m05205 actin, putative very strong similarity ... 149 2e-36 At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Ara... 142 1e-34 At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 A... 128 3e-30 At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Ac... 126 1e-29 At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary id... 95 4e-20 At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identica... 74 7e-14 At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly i... 66 1e-11 At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly i... 65 3e-11 At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identica... 57 9e-09 At5g56180.1 68418.m07008 actin-related protein, putative (ARP8) ... 48 5e-06 At3g12380.1 68416.m01543 actin/actin-like family protein similar... 44 7e-05 At5g43500.2 68418.m05318 expressed protein 40 8e-04 At5g43500.1 68418.m05319 expressed protein 40 8e-04 At1g69270.1 68414.m07941 leucine-rich repeat family protein / pr... 30 0.89 At5g46330.1 68418.m05703 leucine-rich repeat transmembrane prote... 29 1.5 At3g59480.1 68416.m06636 pfkB-type carbohydrate kinase family pr... 29 2.7 At4g00750.1 68417.m00102 dehydration-responsive family protein s... 28 3.6 At3g14720.1 68416.m01861 mitogen-activated protein kinase, putat... 28 4.7 At2g42760.1 68415.m05295 expressed protein 28 4.7 At4g32620.1 68417.m04644 expressed protein predicted protein T10... 27 6.2 At4g30340.1 68417.m04312 diacylglycerol kinase family protein co... 27 6.2 At5g56690.1 68418.m07076 F-box family protein contains F-box dom... 27 8.3 At2g18730.1 68415.m02181 diacylglycerol kinase, putative contain... 27 8.3 >At5g09810.1 68418.m01135 actin 7 (ACT7) / actin 2 identical to SP|P53492 Actin 7 (Actin-2) {Arabidopsis thaliana} Length = 377 Score = 166 bits (403), Expect = 1e-41 Identities = 76/85 (89%), Positives = 81/85 (95%) Frame = -2 Query: 508 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA 329 DIRKDLY N VLSGG+TM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILA Sbjct: 290 DIRKDLYGNIVLSGGSTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILA 349 Query: 328 SLSTFQQMWISKQEYDESGPSIVHR 254 SLSTFQQMWISK EYDESGPSIVHR Sbjct: 350 SLSTFQQMWISKSEYDESGPSIVHR 374 Score = 33.5 bits (73), Expect = 0.095 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 546 HETTYNSIMKCDV 508 HETTYNSIMKCDV Sbjct: 277 HETTYNSIMKCDV 289 >At3g53750.1 68416.m05938 actin 3 (ACT3) identical to SP|P53493 Actin 3 {Arabidopsis thaliana}; supported by full-length cDNA: Ceres: 19581. Length = 377 Score = 166 bits (403), Expect = 1e-41 Identities = 76/85 (89%), Positives = 81/85 (95%) Frame = -2 Query: 508 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA 329 DIRKDLY N VLSGGTTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILA Sbjct: 290 DIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILA 349 Query: 328 SLSTFQQMWISKQEYDESGPSIVHR 254 SLSTFQQMWI+K EYDESGPSIVHR Sbjct: 350 SLSTFQQMWIAKAEYDESGPSIVHR 374 Score = 33.5 bits (73), Expect = 0.095 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 546 HETTYNSIMKCDV 508 HETTYNSIMKCDV Sbjct: 277 HETTYNSIMKCDV 289 >At3g12110.1 68416.m01507 actin 11 (ACT11) identical to SP|P53496 Actin 11 {Arabidopsis thaliana} Length = 377 Score = 166 bits (403), Expect = 1e-41 Identities = 76/85 (89%), Positives = 81/85 (95%) Frame = -2 Query: 508 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA 329 DIRKDLY N VLSGGTTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILA Sbjct: 290 DIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILA 349 Query: 328 SLSTFQQMWISKQEYDESGPSIVHR 254 SLSTFQQMWI+K EYDESGPSIVHR Sbjct: 350 SLSTFQQMWIAKAEYDESGPSIVHR 374 Score = 33.5 bits (73), Expect = 0.095 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 546 HETTYNSIMKCDV 508 HETTYNSIMKCDV Sbjct: 277 HETTYNSIMKCDV 289 >At2g37620.1 68415.m04615 actin 1 (ACT1) identical to SP|P10671 Actin 1 (Actin 3) {Arabidopsis thaliana} Length = 377 Score = 166 bits (403), Expect = 1e-41 Identities = 76/85 (89%), Positives = 81/85 (95%) Frame = -2 Query: 508 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA 329 DIRKDLY N VLSGGTTM+PGIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILA Sbjct: 290 DIRKDLYGNIVLSGGTTMFPGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILA 349 Query: 328 SLSTFQQMWISKQEYDESGPSIVHR 254 SLSTFQQMWI+K EYDESGPSIVHR Sbjct: 350 SLSTFQQMWIAKAEYDESGPSIVHR 374 Score = 33.5 bits (73), Expect = 0.095 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 546 HETTYNSIMKCDV 508 HETTYNSIMKCDV Sbjct: 277 HETTYNSIMKCDV 289 >At3g18780.2 68416.m02386 actin 2 (ACT2) identical to SP|Q96292 Actin 2 {Arabidopsis thaliana}; nearly identical to SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and to At1g49240 Length = 377 Score = 161 bits (391), Expect = 3e-40 Identities = 74/85 (87%), Positives = 79/85 (92%) Frame = -2 Query: 508 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA 329 DIRKDLY N VLSGGTTM+ GIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILA Sbjct: 290 DIRKDLYGNIVLSGGTTMFSGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILA 349 Query: 328 SLSTFQQMWISKQEYDESGPSIVHR 254 SLSTFQQMWISK EYDE+GP IVHR Sbjct: 350 SLSTFQQMWISKAEYDEAGPGIVHR 374 Score = 33.5 bits (73), Expect = 0.095 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 546 HETTYNSIMKCDV 508 HETTYNSIMKCDV Sbjct: 277 HETTYNSIMKCDV 289 >At1g49240.1 68414.m05520 actin 8 (ACT8) identical to SP|Q96293 Actin 8 {Arabidopsis thaliana}; nearly identical to SP|Q96292 Actin 2 [Arabidopsis thaliana] GI:1669387, and to At3g18780 Length = 377 Score = 161 bits (391), Expect = 3e-40 Identities = 74/85 (87%), Positives = 79/85 (92%) Frame = -2 Query: 508 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA 329 DIRKDLY N VLSGGTTM+ GIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILA Sbjct: 290 DIRKDLYGNIVLSGGTTMFSGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILA 349 Query: 328 SLSTFQQMWISKQEYDESGPSIVHR 254 SLSTFQQMWISK EYDE+GP IVHR Sbjct: 350 SLSTFQQMWISKAEYDEAGPGIVHR 374 Score = 33.5 bits (73), Expect = 0.095 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 546 HETTYNSIMKCDV 508 HETTYNSIMKCDV Sbjct: 277 HETTYNSIMKCDV 289 >At5g59370.1 68418.m07440 actin 4 (ACT4) identical to SP|P53494 Actin 4 {Arabidopsis thaliana} Length = 377 Score = 161 bits (390), Expect = 4e-40 Identities = 74/85 (87%), Positives = 79/85 (92%) Frame = -2 Query: 508 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA 329 DIRKDLY N VLSGGTTM+ GI DRM KEITALAPS+MKIK++APPERKYSVWIGGSILA Sbjct: 290 DIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILA 349 Query: 328 SLSTFQQMWISKQEYDESGPSIVHR 254 SLSTFQQMWI+K EYDESGPSIVHR Sbjct: 350 SLSTFQQMWIAKAEYDESGPSIVHR 374 Score = 33.5 bits (73), Expect = 0.095 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 546 HETTYNSIMKCDV 508 HETTYNSIMKCDV Sbjct: 277 HETTYNSIMKCDV 289 >At3g46520.1 68416.m05050 actin 12 (ACT12) identical to SP|P53497 Actin 12 {Arabidopsis thaliana} Length = 377 Score = 161 bits (390), Expect = 4e-40 Identities = 74/85 (87%), Positives = 79/85 (92%) Frame = -2 Query: 508 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA 329 DIRKDLY N VLSGGTTM+ GI DRM KEITALAPS+MKIK++APPERKYSVWIGGSILA Sbjct: 290 DIRKDLYGNIVLSGGTTMFGGIGDRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILA 349 Query: 328 SLSTFQQMWISKQEYDESGPSIVHR 254 SLSTFQQMWI+K EYDESGPSIVHR Sbjct: 350 SLSTFQQMWIAKAEYDESGPSIVHR 374 Score = 33.5 bits (73), Expect = 0.095 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 546 HETTYNSIMKCDV 508 HETTYNSIMKCDV Sbjct: 277 HETTYNSIMKCDV 289 >At2g42100.1 68415.m05205 actin, putative very strong similarity to SP|P53496 Actin 11 {Arabidopsis thaliana}, SP|P53493 Actin 3 {Arabidopsis thaliana}; contains Pfam profile PF00022: Actin Length = 378 Score = 149 bits (360), Expect = 2e-36 Identities = 67/85 (78%), Positives = 75/85 (88%) Frame = -2 Query: 508 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA 329 DIRKDLY N VLSGGTTM+PGIADRM KEI ALAP +MKIK++APPERKYSVW+GGSILA Sbjct: 291 DIRKDLYGNIVLSGGTTMFPGIADRMNKEINALAPPSMKIKVVAPPERKYSVWVGGSILA 350 Query: 328 SLSTFQQMWISKQEYDESGPSIVHR 254 SLS+F MWI+K EYDE G +IVHR Sbjct: 351 SLSSFAPMWITKAEYDEQGGAIVHR 375 Score = 33.5 bits (73), Expect = 0.095 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 546 HETTYNSIMKCDV 508 HETTYNSIMKCDV Sbjct: 278 HETTYNSIMKCDV 290 >At2g42170.1 68415.m05219 actin, putative similar to actin 2 [Arabidopsis thaliana] gi|9293903|dbj|BAB01806 Length = 329 Score = 142 bits (344), Expect = 1e-34 Identities = 64/84 (76%), Positives = 75/84 (89%) Frame = -2 Query: 508 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA 329 DIRKDLY N VLSGGTTM+ GI +RM KEI ALA + M+IKI+APPERKYSVWIGGSILA Sbjct: 242 DIRKDLYGNIVLSGGTTMFRGIEERMTKEINALAAANMRIKIVAPPERKYSVWIGGSILA 301 Query: 328 SLSTFQQMWISKQEYDESGPSIVH 257 SLST++QMWI+K EY+E+GP+IVH Sbjct: 302 SLSTYEQMWITKAEYEENGPAIVH 325 Score = 29.5 bits (63), Expect = 1.5 Identities = 11/12 (91%), Positives = 11/12 (91%) Frame = -3 Query: 546 HETTYNSIMKCD 511 HE TYNSIMKCD Sbjct: 229 HEKTYNSIMKCD 240 >At3g18780.1 68416.m02385 actin 2 (ACT2) identical to SP|Q96292 Actin 2 {Arabidopsis thaliana}; nearly identical to SP|Q96293 Actin 8 [Arabidopsis thaliana] GI:1669387 and to At1g49240 Length = 371 Score = 128 bits (308), Expect = 3e-30 Identities = 60/72 (83%), Positives = 66/72 (91%) Frame = -2 Query: 508 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA 329 DIRKDLY N VLSGGTTM+ GIADRM KEITALAPS+MKIK++APPERKYSVWIGGSILA Sbjct: 290 DIRKDLYGNIVLSGGTTMFSGIADRMSKEITALAPSSMKIKVVAPPERKYSVWIGGSILA 349 Query: 328 SLSTFQQMWISK 293 SLSTFQQ+ I + Sbjct: 350 SLSTFQQVKIDQ 361 Score = 33.5 bits (73), Expect = 0.095 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = -3 Query: 546 HETTYNSIMKCDV 508 HETTYNSIMKCDV Sbjct: 277 HETTYNSIMKCDV 289 >At2g42090.1 68415.m05204 actin, putative similar to SP|P53496 Actin 11 {Arabidopsis thaliana}; contains Pfam profile PF00022: Actin Length = 366 Score = 126 bits (303), Expect = 1e-29 Identities = 54/85 (63%), Positives = 69/85 (81%) Frame = -2 Query: 508 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILA 329 D R+D+Y N +++GGTTM GI +RM KE+ AL PS+MK+K++ PPE + SVWIGGSILA Sbjct: 279 DTRRDMYGNILMTGGTTMLHGIKERMTKELNALVPSSMKVKVVVPPESECSVWIGGSILA 338 Query: 328 SLSTFQQMWISKQEYDESGPSIVHR 254 SLSTF QMWI+K EY+E G +IVHR Sbjct: 339 SLSTFHQMWITKDEYEEHGAAIVHR 363 >At1g18450.1 68414.m02302 actin-related protein 4 (ARP4) neary identical to actin-related protein 4 (ARP4) [Arabidopsis thaliana] GI:21427463; contains Pfam profile PF00022: Actin; supporting cDNA gi|21427462|gb|AF507912.1| Length = 441 Score = 94.7 bits (225), Expect = 4e-20 Identities = 41/88 (46%), Positives = 65/88 (73%), Gaps = 3/88 (3%) Frame = -2 Query: 508 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAP---PERKYSVWIGGS 338 DIR++LY++ +L+GGT+ + +R++K++ +P + ++K++A ER++SVWIGGS Sbjct: 351 DIRRELYSSILLAGGTSSMQQLKERLEKDLIEESPHSARVKVLASGNTTERRFSVWIGGS 410 Query: 337 ILASLSTFQQMWISKQEYDESGPSIVHR 254 ILASL +FQQMW SK EY+E G S + R Sbjct: 411 ILASLGSFQQMWFSKSEYEEHGASYIQR 438 >At3g60830.1 68416.m06805 actin-related protein 7 (ARP7) identical to actin-related protein 7 (ARP7) [Arabidopsis thaliana] GI:21427469; contains Pfam profile PF00022: Actin Length = 363 Score = 73.7 bits (173), Expect = 7e-14 Identities = 39/100 (39%), Positives = 56/100 (56%), Gaps = 6/100 (6%) Frame = -2 Query: 535 IQLHHEVRRDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERK-- 362 +++ V + + L NTVL GGTT G R QKE L S ++ ++ PPE Sbjct: 262 VRIISTVSSENHRQLLENTVLCGGTTSMTGFESRFQKEAN-LCSSAIRPTLVKPPEYMPE 320 Query: 361 ----YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR 254 YS W+GG+ILA + Q ++K +YDE+GPS+VHR Sbjct: 321 NLGMYSAWVGGAILAKVVFPQNQHVTKADYDETGPSVVHR 360 >At3g33520.1 68416.m04291 actin-related protein 6 (ARP6) nearly identical to actin-related protein 6 (ARP6) [Arabidopsis thaliana] GI:21427467; contains Pfam profile PF00022: Actin Length = 421 Score = 66.5 bits (155), Expect = 1e-11 Identities = 29/80 (36%), Positives = 48/80 (60%) Frame = -2 Query: 493 LYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTF 314 LY + +L+GG+T++P + +R++ E+ L P +KI + VW GGS+LAS F Sbjct: 338 LYQSIILTGGSTLFPQLKERLEGELRPLVPDHFDVKITTQEDPILGVWRGGSLLASSPDF 397 Query: 313 QQMWISKQEYDESGPSIVHR 254 + M ++K EY+E G + R Sbjct: 398 ESMCVTKAEYEELGSARCRR 417 >At3g27000.1 68416.m03378 actin-related protein 2 (ARP2) nearly identical to actin-related protein 2 (ARP2) [Arabidopsis thaliana] GI:3818624; contains Pfam profile PF00022: Actin Length = 389 Score = 64.9 bits (151), Expect = 3e-11 Identities = 36/101 (35%), Positives = 62/101 (61%), Gaps = 12/101 (11%) Frame = -2 Query: 520 EVRRDIRKDLYANTVLSGGTTMYPGIADRMQKEI------TALAPS-----TMKIKIIAP 374 E+ D R LY + VLSGG+TMYPG+ R++KEI T L + ++++I P Sbjct: 285 EMDIDNRMMLYQHIVLSGGSTMYPGLPSRLEKEIQDRYLDTVLKGNKDGLKKLRLRIEDP 344 Query: 373 PERKYSVWIGGSILAS-LSTFQQMWISKQEYDESGPSIVHR 254 P RK+ V++GG++LA + + WI++++Y E G + +++ Sbjct: 345 PRRKHMVYLGGAVLAGIMKDAPEFWINREDYMEEGINCLNK 385 >At1g13180.1 68414.m01528 actin-related protein 3 (ARP3) identical to actin-related protein 3 (ARP3) [Arabidopsis thaliana] GI:21427461; contains Pfam profile PF00022: Actin Length = 427 Score = 56.8 bits (131), Expect = 9e-09 Identities = 30/98 (30%), Positives = 54/98 (55%), Gaps = 16/98 (16%) Frame = -2 Query: 508 DIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTM----------------KIKIIA 377 D R+ LY N VLSGG+TM+ R+Q+++ + + + ++ +++ Sbjct: 319 DTRRALYKNIVLSGGSTMFKDFGRRLQRDLKKIVDARVLANNARTGGEITSQPVEVNVVS 378 Query: 376 PPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSI 263 P ++++VW GGS+L+S F +K+EY+E G SI Sbjct: 379 HPVQRFAVWFGGSVLSSTPEFFASCRTKEEYEEYGASI 416 >At5g56180.1 68418.m07008 actin-related protein, putative (ARP8) strong similarity to actin-related protein 8A (ARP8) [Arabidopsis thaliana] GI:21427473; contains Pfam profile PF00022: Actin; supporting cDNA gi|21427470|gb|AF507916.1| Length = 471 Score = 47.6 bits (108), Expect = 5e-06 Identities = 21/72 (29%), Positives = 45/72 (62%), Gaps = 3/72 (4%) Frame = -2 Query: 490 YANTVLSGGTTMYPGIADRMQKEITALAPSTMK--IKIIAPPERKYSVWIGGSILASLST 317 + VL+GG+ PG+++R+++E+ PS++ I++I PP + W G ++++LS Sbjct: 392 FKTVVLTGGSACLPGLSERLERELQDHLPSSISNGIRVIPPPYGVDTSWHGAKLISNLSI 451 Query: 316 FQQMW-ISKQEY 284 F W I+++++ Sbjct: 452 FPGPWCITRKQF 463 >At3g12380.1 68416.m01543 actin/actin-like family protein similar to SP|P53946 Actin-like protein ARP5 {Saccharomyces cerevisiae}; contains Pfam profile PF00022: Actin Length = 724 Score = 44.0 bits (99), Expect = 7e-05 Identities = 21/87 (24%), Positives = 45/87 (51%) Frame = -2 Query: 532 QLHHEVRRDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSV 353 +L H+ +++ + L ++ +++GG ++ PG+ +R++ I + P I ++ + Sbjct: 625 RLPHD-EKELEERLTSSILMTGGCSLLPGMNERLECGIRMIRPCGSPINVVRAMDPVLDA 683 Query: 352 WIGGSILASLSTFQQMWISKQEYDESG 272 W G S A+ F +K +YDE G Sbjct: 684 WRGASAFAANLNFLGNAFTKMDYDEKG 710 >At5g43500.2 68418.m05318 expressed protein Length = 584 Score = 40.3 bits (90), Expect = 8e-04 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 4/85 (4%) Frame = -2 Query: 514 RRDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKII----APPERKYSVWI 347 R D+R+ L+++ L GG + G+ +++ + P T I + + E ++ W Sbjct: 475 RIDLRRKLFSSIQLIGGAGLTKGLVAAVEERVLHAIPPTEAIDTVQVLPSRTEPQFVTWK 534 Query: 346 GGSILASLSTFQQMWISKQEYDESG 272 GG+IL L ++ WI + ++ +G Sbjct: 535 GGAILGILDFGREAWIERHQWMVNG 559 >At5g43500.1 68418.m05319 expressed protein Length = 596 Score = 40.3 bits (90), Expect = 8e-04 Identities = 21/85 (24%), Positives = 43/85 (50%), Gaps = 4/85 (4%) Frame = -2 Query: 514 RRDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKII----APPERKYSVWI 347 R D+R+ L+++ L GG + G+ +++ + P T I + + E ++ W Sbjct: 487 RIDLRRKLFSSIQLIGGAGLTKGLVAAVEERVLHAIPPTEAIDTVQVLPSRTEPQFVTWK 546 Query: 346 GGSILASLSTFQQMWISKQEYDESG 272 GG+IL L ++ WI + ++ +G Sbjct: 547 GGAILGILDFGREAWIERHQWMVNG 571 >At1g69270.1 68414.m07941 leucine-rich repeat family protein / protein kinase family protein contains Pfam domains PF00560: Leucine Rich Repeat and PF00069: Protein kinase domain Length = 540 Score = 30.3 bits (65), Expect = 0.89 Identities = 13/26 (50%), Positives = 16/26 (61%), Gaps = 1/26 (3%) Frame = +2 Query: 347 DPYGVLPLWGSNDLNLHCRW-GESCD 421 DP GVL W S+ + HC W G SC+ Sbjct: 45 DPNGVLSSWVSDSSSNHCSWYGVSCN 70 >At5g46330.1 68418.m05703 leucine-rich repeat transmembrane protein kinase, putative Length = 1173 Score = 29.5 bits (63), Expect = 1.5 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 1/37 (2%) Frame = +2 Query: 341 STDPYGVLPLWGSNDLNLHCRW-GESCDFLLHTVGDS 448 S DP GVL W HC W G +CD H V S Sbjct: 42 SNDPLGVLSDWTIIGSLRHCNWTGITCDSTGHVVSVS 78 >At3g59480.1 68416.m06636 pfkB-type carbohydrate kinase family protein contains Pfam profile: PF00294 pfkB family carbohydrate kinase Length = 326 Score = 28.7 bits (61), Expect = 2.7 Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 4/57 (7%) Frame = +2 Query: 227 LKVSTLRSTSVYN-GGTRLVVLLFRDPHL--LE-GREGGEDRSTDPYGVLPLWGSND 385 L + +RS V++ G L+V R HL +E +E G S DP LPLW S + Sbjct: 127 LNLDVIRSAKVFHYGSISLIVEPCRSAHLKAMEVAKEAGALLSYDPNLRLPLWPSKE 183 >At4g00750.1 68417.m00102 dehydration-responsive family protein similar to early-responsive to dehydration stress ERD3 protein [Arabidopsis thaliana] GI:15320410; contains Pfam profile PF03141: Putative methyltransferase Length = 633 Score = 28.3 bits (60), Expect = 3.6 Identities = 11/37 (29%), Positives = 22/37 (59%) Frame = -1 Query: 386 DHCSPREEVLRMDRWIDPRLPLYLPTDVDLETGVRRV 276 D C + +L MDR + P+ + + D+D+ T V+++ Sbjct: 555 DRCDMEDILLEMDRILRPKGSVIIRDDIDVLTKVKKI 591 >At3g14720.1 68416.m01861 mitogen-activated protein kinase, putative / MAPK, putative (MPK19) identical to mitogen-activated protein kinase (MAPK)(AtMPK19), PMID:12119167; Length = 586 Score = 27.9 bits (59), Expect = 4.7 Identities = 15/63 (23%), Positives = 33/63 (52%) Frame = -2 Query: 544 RDHIQLHHEVRRDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPER 365 R+ ++ H ++ +D Y N+ G + +YP ++K+ L ++ K + PP+R Sbjct: 342 REILEYHPQLLKD-----YMNS--EGSSFLYPSAIGHLRKQFAYLEENSGKSGPVIPPDR 394 Query: 364 KYS 356 K++ Sbjct: 395 KHA 397 >At2g42760.1 68415.m05295 expressed protein Length = 267 Score = 27.9 bits (59), Expect = 4.7 Identities = 17/53 (32%), Positives = 30/53 (56%), Gaps = 1/53 (1%) Frame = -1 Query: 425 GNHSSRPIDNED*DHCSPREEVLRMDRWIDPRLPL-YLPTDVDLETGVRRVWS 270 GN ++RP +E DHC R+ ++ I R+P ++VDL+ + R+W+ Sbjct: 207 GNRAARPYLSEAWDHCGGRKGKKQITPEIKWRVPAPAAASEVDLKDNL-RLWA 258 >At4g32620.1 68417.m04644 expressed protein predicted protein T10M13.8, Arabidopsis thaliana Length = 1544 Score = 27.5 bits (58), Expect = 6.2 Identities = 17/33 (51%), Positives = 19/33 (57%), Gaps = 2/33 (6%) Frame = +2 Query: 338 RSTDPYGV--LPLWGSNDLNLHCRWGESCDFLL 430 +S DP GV LP+ S DL L C W ES F L Sbjct: 572 KSPDP-GVEFLPIEDSGDLELCCPWNESEQFEL 603 >At4g30340.1 68417.m04312 diacylglycerol kinase family protein contains INTERPRO domain, IPR001206, DAG-kinase catalytic domain Length = 374 Score = 27.5 bits (58), Expect = 6.2 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 350 PYGVLPLWGSNDLNLHCRWGESCDF 424 P GV+PL NDL+ WG S F Sbjct: 192 PVGVIPLGTGNDLSRSFSWGGSFPF 216 >At5g56690.1 68418.m07076 F-box family protein contains F-box domain Pfam:PF00646 Length = 402 Score = 27.1 bits (57), Expect = 8.3 Identities = 18/49 (36%), Positives = 27/49 (55%) Frame = -2 Query: 424 EITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 278 EI+ L P + +KI+A K V I S+L+ F MW+ K +YD+ Sbjct: 3 EISGL-PDDLLVKILAFLPTK--VAISTSVLSKQWRFLWMWLPKLKYDD 48 >At2g18730.1 68415.m02181 diacylglycerol kinase, putative contains INTERPRO domain, IPR001206, DAG-kinase catalytic domain Length = 488 Score = 27.1 bits (57), Expect = 8.3 Identities = 12/25 (48%), Positives = 14/25 (56%) Frame = +2 Query: 350 PYGVLPLWGSNDLNLHCRWGESCDF 424 P GV+PL NDL+ WG S F Sbjct: 189 PVGVIPLGTGNDLSRSFGWGGSFPF 213 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 11,869,128 Number of Sequences: 28952 Number of extensions: 242520 Number of successful extensions: 750 Number of sequences better than 10.0: 31 Number of HSP's better than 10.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 744 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1033331880 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -