BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0122.Seq (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_41974| Best HMM Match : No HMM Matches (HMM E-Value=.) 97 9e-21 SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 68 5e-12 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 67 1e-11 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 67 1e-11 SB_11166| Best HMM Match : CARD (HMM E-Value=0.001) 67 1e-11 SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) 66 2e-11 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) 66 2e-11 SB_2194| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_1898| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_11959| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 2e-11 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 66 3e-11 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 65 4e-11 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 65 4e-11 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 65 4e-11 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 65 4e-11 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 65 4e-11 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 65 4e-11 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 65 4e-11 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 65 4e-11 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 65 4e-11 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 65 4e-11 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 65 4e-11 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 65 4e-11 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 65 4e-11 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 65 4e-11 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 65 4e-11 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 65 4e-11 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 65 4e-11 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 65 4e-11 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 65 4e-11 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 65 4e-11 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 65 4e-11 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 65 4e-11 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 65 4e-11 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 65 4e-11 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 65 4e-11 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 65 4e-11 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 65 4e-11 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 65 4e-11 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 65 4e-11 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 65 4e-11 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_23287| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 65 4e-11 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_22377| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 65 4e-11 SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_21996| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_21918| Best HMM Match : STT3 (HMM E-Value=0) 65 4e-11 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 65 4e-11 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_20759| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_20660| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_20556| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_20335| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_20328| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 65 4e-11 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 65 4e-11 SB_19740| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_19737| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_19732| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_19598| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 65 4e-11 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_17561| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) 65 4e-11 SB_17363| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 65 4e-11 SB_16122| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_15827| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_15736| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_15584| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 65 4e-11 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_14827| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.8) 65 4e-11 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_14253| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 65 4e-11 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_13737| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_13672| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_13401| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 65 4e-11 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) 65 4e-11 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_13059| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 65 4e-11 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 65 4e-11 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_12508| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_12176| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_11796| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_11690| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_11016| Best HMM Match : DUF726 (HMM E-Value=1.3e-08) 65 4e-11 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) 65 4e-11 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_9919| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 65 4e-11 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 65 4e-11 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_8043| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_7679| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 65 4e-11 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_7304| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 65 4e-11 SB_7027| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_6958| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_5084| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_4603| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 65 4e-11 SB_4554| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_4385| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_4363| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_4332| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 65 4e-11 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 65 4e-11 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_3391| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) 65 4e-11 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_2377| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_2289| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_2177| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_1887| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_1459| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_1407| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_1055| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_931| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_740| Best HMM Match : DUF1131 (HMM E-Value=4.8) 65 4e-11 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_278| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59734| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59691| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59574| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59521| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59292| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_59178| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58804| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58763| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58688| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58626| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58592| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58350| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58307| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58237| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58200| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58039| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_58005| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57995| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57875| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57777| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57569| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57528| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57143| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57123| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57090| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_57030| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56965| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56957| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56894| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56871| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56844| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56822| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56749| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56710| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56549| Best HMM Match : Spermine_synth (HMM E-Value=1.5e-29) 65 4e-11 SB_56502| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56306| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56302| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_56297| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55990| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55770| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55660| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55650| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55432| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55411| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55260| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55243| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55206| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55098| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55086| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55059| Best HMM Match : Orn_Arg_deC_N (HMM E-Value=0) 65 4e-11 SB_55041| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_55000| Best HMM Match : DUF765 (HMM E-Value=3.9) 65 4e-11 SB_54982| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_54744| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 SB_54502| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 4e-11 >SB_41974| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 97.1 bits (231), Expect = 9e-21 Identities = 43/65 (66%), Positives = 55/65 (84%) Frame = +1 Query: 22 MVSKAELACVYSALILVDDDVAVTGEKISTILKAAAVDVEPYWPGLFAKALEGINVRDLI 201 M S +ELACVYSALIL DDDVA+T +KI T++KAA ++VEP+WPGLFAKAL+G N+ DLI Sbjct: 1 MASTSELACVYSALILHDDDVAITADKIETLVKAAKINVEPFWPGLFAKALQGHNIADLI 60 Query: 202 TNIGS 216 + G+ Sbjct: 61 LSAGA 65 >SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) Length = 333 Score = 68.1 bits (159), Expect = 5e-12 Identities = 36/58 (62%), Positives = 42/58 (72%), Gaps = 3/58 (5%) Frame = +1 Query: 433 IKISSGREFDIKLIDTVDLEGGP---GTHSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 +K +SG E+ D + LE P ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 204 VKTASGAEYQSPG-DPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 260 >SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) Length = 889 Score = 66.9 bits (156), Expect = 1e-11 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 3/52 (5%) Frame = +1 Query: 451 REFDIKLIDTVDLEGGP---GTHSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 R+ D+ D + LE P ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 102 RQEDVLPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 153 >SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 682 Score = 66.9 bits (156), Expect = 1e-11 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 3/57 (5%) Frame = +1 Query: 436 KISSGREFDIKLIDTVDLEGGP---GTHSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 KI S R D + LE P ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 553 KILSDRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 609 >SB_11166| Best HMM Match : CARD (HMM E-Value=0.001) Length = 720 Score = 66.9 bits (156), Expect = 1e-11 Identities = 35/58 (60%), Positives = 40/58 (68%), Gaps = 3/58 (5%) Frame = +1 Query: 433 IKISSGREFDIKLIDTVDLEGGP---GTHSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 I + R +I D + LE P ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 590 ISLPKKRRSNINPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 647 >SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) Length = 458 Score = 66.5 bits (155), Expect = 2e-11 Identities = 33/56 (58%), Positives = 41/56 (73%), Gaps = 3/56 (5%) Frame = +1 Query: 439 ISSGREFDIKLIDTVDLEGGP---GTHSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 +++ + I++ D LE P ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 94 VTASGDKTIRIWDARILERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 149 >SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 190 Score = 66.5 bits (155), Expect = 2e-11 Identities = 41/82 (50%), Positives = 47/82 (57%), Gaps = 8/82 (9%) Frame = +1 Query: 376 IKIFHFVYCKAFML*ETDFIKISS-----GREFDIKLIDTVDLEGGP---GTHSPYSESY 531 I++F CK L +F S GR D + LE P ++SPYSESY Sbjct: 36 IRLFEGFTCKPKRLCSREFCASLSRLQRQGRSNSCSPGDPLVLERPPPRWSSNSPYSESY 95 Query: 532 YNXLAVVLQRRDWENPGVTQLN 597 YN LAVVLQRRDWENPGVTQLN Sbjct: 96 YNSLAVVLQRRDWENPGVTQLN 117 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/26 (73%), Positives = 21/26 (80%), Gaps = 1/26 (3%) Frame = -2 Query: 534 VIRLTIG-RMGTGPPLEVDGIDKLDI 460 +I IG + GTGPPLEVDGIDKLDI Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDI 33 >SB_12682| Best HMM Match : DUF1336 (HMM E-Value=3.2) Length = 153 Score = 66.5 bits (155), Expect = 2e-11 Identities = 32/44 (72%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = +1 Query: 475 DTVDLEGGP---GTHSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 D + LE P ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 10 DPLVLEXAPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 53 >SB_2194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 66.5 bits (155), Expect = 2e-11 Identities = 37/62 (59%), Positives = 42/62 (67%), Gaps = 5/62 (8%) Frame = +1 Query: 427 DFIKISSGREFDIKLI--DTVDLEGGP---GTHSPYSESYYNXLAVVLQRRDWENPGVTQ 591 DF+ S + D L D + LE P ++SPYSESYYN LAVVLQRRDWENPGVTQ Sbjct: 3 DFVSNSIKKNIDGALHPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQ 62 Query: 592 LN 597 LN Sbjct: 63 LN 64 >SB_1898| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 252 Score = 66.5 bits (155), Expect = 2e-11 Identities = 34/57 (59%), Positives = 42/57 (73%), Gaps = 3/57 (5%) Frame = +1 Query: 436 KISSGREFDIKLIDTVDLEGGP---GTHSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 + + G + + L++ V LE P ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 124 RTTGGTDGSLLLLNAV-LERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 179 >SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 66.1 bits (154), Expect = 2e-11 Identities = 32/44 (72%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = +1 Query: 475 DTVDLEGGP---GTHSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 D + LE P ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 50 DPLVLERSPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 93 >SB_11959| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 66.1 bits (154), Expect = 2e-11 Identities = 34/50 (68%), Positives = 37/50 (74%), Gaps = 3/50 (6%) Frame = +1 Query: 457 FDIKLIDTVDLEGGP---GTHSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 FD D + LE P ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 417 FDKSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 466 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 66.1 bits (154), Expect = 2e-11 Identities = 32/44 (72%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = +1 Query: 475 DTVDLEGGP---GTHSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 D + LE P ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 23 DPLVLERAPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 66 >SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 66.1 bits (154), Expect = 2e-11 Identities = 32/44 (72%), Positives = 35/44 (79%), Gaps = 3/44 (6%) Frame = +1 Query: 475 DTVDLEGGP---GTHSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 D + LE P ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 30 DPLVLERAPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 73 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 65.7 bits (153), Expect = 3e-11 Identities = 35/54 (64%), Positives = 39/54 (72%), Gaps = 6/54 (11%) Frame = +1 Query: 454 EFDIKLI---DTVDLEGGP---GTHSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 E+D K D + LE P ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 628 EYDTKATSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRDWENPGVTQLN 681 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 32 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 62 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 55 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 85 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 46 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 76 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 23 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 53 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 38 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 68 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 47 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 77 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 28 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 58 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 204 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 234 Score = 37.9 bits (84), Expect = 0.006 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 1/25 (4%) Frame = -2 Query: 534 VIRLTIG-RMGTGPPLEVDGIDKLD 463 +I IG + GTGPPLEVDGIDKLD Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLD 32 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 99 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 129 Score = 37.9 bits (84), Expect = 0.006 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 1/25 (4%) Frame = -2 Query: 534 VIRLTIG-RMGTGPPLEVDGIDKLD 463 +I IG + GTGPPLEVDGIDKLD Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLD 32 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 35 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 65 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 369 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 399 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 27 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 57 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 26 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 56 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 33 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 63 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 328 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 358 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 68 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 98 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 38 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 68 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 47 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 77 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 31 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 61 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 122 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 152 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 51 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 81 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 27 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 57 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 55 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 85 Score = 39.1 bits (87), Expect = 0.003 Identities = 18/18 (100%), Positives = 18/18 (100%) Frame = -3 Query: 506 VPGPPSRSTVSISLISNS 453 VPGPPSRSTVSISLISNS Sbjct: 20 VPGPPSRSTVSISLISNS 37 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 244 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 274 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 24 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 54 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 102 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 132 Score = 38.3 bits (85), Expect = 0.005 Identities = 20/35 (57%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = -2 Query: 534 VIRLTIG-RMGTGPPLEVDGIDKLDIEFAAATYFN 433 +I IG + GTGPPLEVDGIDKLD + T N Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDGNRSTLTVSN 42 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 22 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 52 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 384 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 414 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 107 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 137 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 402 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 432 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 44 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 74 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 34 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 64 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 51 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 81 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 173 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 203 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 22 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 52 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 28 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 58 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 42 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 72 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 39 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 69 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 23 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 53 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 37 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 67 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 27 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 57 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 72 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 102 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 328 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 358 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 74 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 104 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 24 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 54 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 282 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 312 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 45 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 75 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 399 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 429 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 39 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 69 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 31 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 61 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 81 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 111 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 199 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 229 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 31 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 61 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 31 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 61 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 33 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 63 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 23 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 53 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 183 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 213 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 41 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 71 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 74 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 104 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 37 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 67 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 175 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 205 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 55 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 85 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 38 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 68 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 64 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 94 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 84 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 114 Score = 40.3 bits (90), Expect = 0.001 Identities = 21/38 (55%), Positives = 28/38 (73%), Gaps = 1/38 (2%) Frame = -2 Query: 534 VIRLTIG-RMGTGPPLEVDGIDKLDIEFAAATYFNKVS 424 +I IG + GTGPPLEVDGIDKLD + + A Y +K++ Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLD-DTSFALYLSKMT 44 >SB_47213| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 103 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 28 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 58 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 37 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 67 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 36 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 66 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 25 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 55 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 24 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 54 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 31 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 61 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 68 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 98 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 18 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 48 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 33 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 63 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 63 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 93 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 913 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 943 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 34 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 64 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 341 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 371 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 63 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 93 >SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 114 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 144 Score = 37.9 bits (84), Expect = 0.006 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 1/25 (4%) Frame = -2 Query: 534 VIRLTIG-RMGTGPPLEVDGIDKLD 463 +I IG + GTGPPLEVDGIDKLD Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLD 32 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 85 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 115 >SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 42 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 72 >SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 92 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 122 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 35 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 65 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 896 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 926 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 27 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 57 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 31 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 61 >SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 69 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 99 >SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 44 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 74 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 38 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 68 >SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 40 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 70 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 84 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 114 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 63 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 93 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 46 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 76 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 59 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 89 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 35 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 65 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 41 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 71 >SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 44 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 74 >SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 100 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 130 >SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 50 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 80 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 61 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 91 >SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 916 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 813 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 843 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 60 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 90 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 45 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 75 >SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) Length = 872 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 769 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 799 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 35 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 65 >SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) Length = 372 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 59 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 89 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 162 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 192 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 22 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 52 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 30 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 60 >SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 101 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 131 Score = 37.9 bits (84), Expect = 0.006 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 1/25 (4%) Frame = -2 Query: 534 VIRLTIG-RMGTGPPLEVDGIDKLD 463 +I IG + GTGPPLEVDGIDKLD Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLD 32 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 56 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 86 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 81 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 111 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 44 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 74 >SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) Length = 352 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 173 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 203 >SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 24 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 54 >SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 74 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 104 >SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 27 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 57 >SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 22 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 52 >SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) Length = 783 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 544 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 574 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 43 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 73 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 42 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 72 >SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 44 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 74 >SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 54 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 84 >SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 449 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 479 >SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 22 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 52 >SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) Length = 974 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 871 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 901 >SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 224 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 254 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 67 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 97 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 34 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 64 >SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 22 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 52 >SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 23 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 53 >SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 80 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 110 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 1042 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 1072 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 37 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 67 >SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 53 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 83 >SB_30457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 38 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 68 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 141 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 171 >SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) Length = 1312 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 613 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 643 >SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 37 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 67 >SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 73 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 103 Score = 45.6 bits (103), Expect = 3e-05 Identities = 21/26 (80%), Positives = 21/26 (80%) Frame = -3 Query: 596 LSWVTPGFSQSRRCKTTASXL*YDSL 519 LSWVTPGFSQSRRCKTTAS D L Sbjct: 37 LSWVTPGFSQSRRCKTTASEFPGDPL 62 >SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) Length = 340 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 237 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 267 >SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 32 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 62 >SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 28 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 58 >SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 343 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 373 >SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 85 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 115 Score = 39.5 bits (88), Expect = 0.002 Identities = 19/26 (73%), Positives = 21/26 (80%), Gaps = 1/26 (3%) Frame = -2 Query: 534 VIRLTIG-RMGTGPPLEVDGIDKLDI 460 +I IG + GTGPPLEVDGIDKLDI Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDI 33 >SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) Length = 186 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 83 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 113 >SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 43 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 73 >SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 29 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 59 >SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 25 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 55 >SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) Length = 725 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 212 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 242 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 63 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 93 >SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 106 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 17 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 47 >SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 44 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 74 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 65.3 bits (152), Expect = 4e-11 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 505 THSPYSESYYNXLAVVLQRRDWENPGVTQLN 597 ++SPYSESYYN LAVVLQRRDWENPGVTQLN Sbjct: 50 SNSPYSESYYNSLAVVLQRRDWENPGVTQLN 80 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,615,690 Number of Sequences: 59808 Number of extensions: 266787 Number of successful extensions: 3867 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3603 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3864 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -