BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0121.Seq (459 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone recepto... 24 0.78 AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 23 1.4 AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. 22 3.2 AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. 22 3.2 AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxyge... 21 4.2 AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxyge... 21 4.2 AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax pr... 21 5.5 AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax pr... 21 5.5 AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax pr... 21 5.5 AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax pr... 21 5.5 AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax pr... 21 5.5 AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax pr... 21 5.5 AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. 21 5.5 AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax pr... 21 5.5 AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduce... 21 5.5 X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. 21 7.3 AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain tran... 21 7.3 >AM295015-1|CAL25730.1| 549|Tribolium castaneum ecdysone receptor (isoform A) protein. Length = 549 Score = 23.8 bits (49), Expect = 0.78 Identities = 9/21 (42%), Positives = 13/21 (61%) Frame = +3 Query: 381 LQCVVLRKSQDDNKDKXKPTT 443 +QC V RK + K+K KP + Sbjct: 262 VQCAVKRKEKKAQKEKDKPNS 282 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 23.0 bits (47), Expect = 1.4 Identities = 9/15 (60%), Positives = 10/15 (66%) Frame = -1 Query: 153 KVIRRSFTDVKSPYS 109 K RRS+T K PYS Sbjct: 130 KTYRRSYTHAKPPYS 144 >AY800247-1|AAV66724.1| 790|Tribolium castaneum pangolin protein. Length = 790 Score = 21.8 bits (44), Expect = 3.2 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -2 Query: 137 PSPT*SPHTPQGVCHPKL---PPRRTPPCFCHERASVLAERRVPVS 9 P P SPH P HP + P++ P H+ + L +++P++ Sbjct: 232 PHPGLSPHPPHLSSHPAIVTPGPKQELPDLNHKPLN-LTIKKMPIA 276 >AY800246-1|AAV66723.1| 682|Tribolium castaneum pangolin protein. Length = 682 Score = 21.8 bits (44), Expect = 3.2 Identities = 13/46 (28%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -2 Query: 137 PSPT*SPHTPQGVCHPKL---PPRRTPPCFCHERASVLAERRVPVS 9 P P SPH P HP + P++ P H+ + L +++P++ Sbjct: 124 PHPGLSPHPPHLSSHPAIVTPGPKQELPDLNHKPLN-LTIKKMPIA 168 >AY052392-1|AAL15466.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 4.2 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = +3 Query: 270 HSTWARWGFLTPFEFNNFQEQVMNVLEGHAALTLRSRLQCVVL 398 H + W +E ++ + +VLE L + RL VVL Sbjct: 58 HQAYELWFKQIIYELDSIRNIFSDVLEESQTLEILKRLNRVVL 100 >AY052390-1|AAL15464.1| 388|Tribolium castaneum tryptophan oxygenase protein. Length = 388 Score = 21.4 bits (43), Expect = 4.2 Identities = 12/43 (27%), Positives = 19/43 (44%) Frame = +3 Query: 270 HSTWARWGFLTPFEFNNFQEQVMNVLEGHAALTLRSRLQCVVL 398 H + W +E ++ + +VLE L + RL VVL Sbjct: 58 HQAYELWFKQIIYELDSIRNIFSDVLEESQTLEILKRLNRVVL 100 >AY055847-1|AAL23667.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 5.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 113 TPQGVCHPKLPPRRTPP 63 +PQ + PPR TPP Sbjct: 112 SPQDLSTNGAPPRSTPP 128 >AY055846-1|AAL26542.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 5.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 113 TPQGVCHPKLPPRRTPP 63 +PQ + PPR TPP Sbjct: 112 SPQDLSTNGAPPRSTPP 128 >AY055845-1|AAL23670.2| 230|Tribolium castaneum cephalothorax protein. Length = 230 Score = 21.0 bits (42), Expect = 5.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 113 TPQGVCHPKLPPRRTPP 63 +PQ + PPR TPP Sbjct: 112 SPQDLSTNGAPPRSTPP 128 >AF426396-1|AAL27023.2| 312|Tribolium castaneum cephalothorax protein. Length = 312 Score = 21.0 bits (42), Expect = 5.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 113 TPQGVCHPKLPPRRTPP 63 +PQ + PPR TPP Sbjct: 112 SPQDLSTNGAPPRSTPP 128 >AF426395-1|AAL27022.2| 297|Tribolium castaneum cephalothorax protein. Length = 297 Score = 21.0 bits (42), Expect = 5.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 113 TPQGVCHPKLPPRRTPP 63 +PQ + PPR TPP Sbjct: 112 SPQDLSTNGAPPRSTPP 128 >AF416773-1|AAL09697.1| 268|Tribolium castaneum cephalothorax protein. Length = 268 Score = 21.0 bits (42), Expect = 5.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 113 TPQGVCHPKLPPRRTPP 63 +PQ + PPR TPP Sbjct: 68 SPQDLSTNGAPPRSTPP 84 >AF321227-2|AAK16422.1| 312|Tribolium castaneum Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 5.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 113 TPQGVCHPKLPPRRTPP 63 +PQ + PPR TPP Sbjct: 112 SPQDLSTNGAPPRSTPP 128 >AF261823-1|AAG13010.1| 157|Tribolium castaneum cephalothorax protein. Length = 157 Score = 21.0 bits (42), Expect = 5.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 113 TPQGVCHPKLPPRRTPP 63 +PQ + PPR TPP Sbjct: 112 SPQDLSTNGAPPRSTPP 128 >AF227628-1|AAF42868.1| 312|Tribolium castaneum sex combs reduced Scr protein. Length = 312 Score = 21.0 bits (42), Expect = 5.5 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = -2 Query: 113 TPQGVCHPKLPPRRTPP 63 +PQ + PPR TPP Sbjct: 112 SPQDLSTNGAPPRSTPP 128 >X91618-1|CAA62821.1| 524|Tribolium castaneum hunchback protein. Length = 524 Score = 20.6 bits (41), Expect = 7.3 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = -1 Query: 432 SSCLYCRLDFSEAL 391 +SC YC + F +A+ Sbjct: 471 NSCQYCNIAFGDAV 484 >AY043292-1|AAK96031.1| 323|Tribolium castaneum homeodomain transcription factor Prothoraxlessprotein. Length = 323 Score = 20.6 bits (41), Expect = 7.3 Identities = 6/11 (54%), Positives = 9/11 (81%) Frame = -2 Query: 110 PQGVCHPKLPP 78 PQG+ +P+ PP Sbjct: 75 PQGMPYPRFPP 85 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 100,987 Number of Sequences: 336 Number of extensions: 1873 Number of successful extensions: 17 Number of sequences better than 10.0: 17 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 52 effective length of database: 105,113 effective search space used: 10511300 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -