BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0121.Seq (459 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 11_01_0574 + 4582098-4582331,4582450-4582492,4582683-4582757,458... 44 6e-05 01_07_0230 + 42170382-42170408,42170532-42170648,42171930-421721... 39 0.002 05_04_0161 + 18635635-18635788,18637117-18637295,18638032-186381... 30 1.0 05_05_0165 + 22851863-22852566,22852811-22852964,22853112-228532... 29 1.4 03_06_0074 - 31476094-31476215,31477803-31478238,31478438-314784... 29 1.4 04_03_0972 + 21347212-21347284,21347966-21348009,21348153-213482... 28 3.1 03_06_0004 + 30936670-30936726,30936858-30936905,30937045-309370... 28 3.1 05_04_0183 - 18849749-18850225,18850305-18850431,18851762-18853515 27 5.5 12_02_0792 - 23191120-23191313,23191419-23191775,23192027-231921... 27 7.3 06_02_0041 + 10889741-10890092,10890161-10890235,10891139-108923... 27 7.3 05_03_0117 + 8580270-8580677,8581541-8582328,8582412-8582663,858... 27 7.3 05_07_0280 - 28920864-28920971,28921076-28921175,28921267-289213... 27 9.6 04_03_0091 - 11043023-11043090,11043458-11043566,11044431-110445... 27 9.6 03_05_0916 - 28762214-28762414,28763144-28763242,28763573-287639... 27 9.6 03_05_0543 - 25404630-25405408,25405461-25405605 27 9.6 03_05_0340 + 23294044-23294166,23294395-23294640,23294907-232949... 27 9.6 >11_01_0574 + 4582098-4582331,4582450-4582492,4582683-4582757, 4584344-4584465,4584547-4584654,4585975-4586119, 4586786-4586869,4586997-4587345,4587527-4587666, 4587784-4588037,4588409-4588576,4588686-4588976, 4589329-4589538,4589778-4589860,4590288-4590414, 4593624-4595516,4596274-4596395,4596487-4596628, 4596719-4596940,4597489-4597563,4598351-4598452, 4598616-4598819 Length = 1730 Score = 44.0 bits (99), Expect = 6e-05 Identities = 29/89 (32%), Positives = 46/89 (51%) Frame = +2 Query: 29 QLVHWLVHDKSMVVFVEAAVLDDTLLAEYGDFTSVKERLMTFRASTDDLTDKIDFIICLG 208 ++ +L H + M V VE V D + A + V+ + T DL +++DF+ CLG Sbjct: 1442 EVASFLHHQEKMNVLVEPDVHD--IFARIPGYGFVQT---FYTQDTSDLHERVDFVACLG 1496 Query: 209 GDRDPXGC*LTFSSNRAAVMAFHLGSLGF 295 GD F ++ V++F+LGSLGF Sbjct: 1497 GDGVILHASNLFRTSVPPVVSFNLGSLGF 1525 Score = 42.3 bits (95), Expect = 2e-04 Identities = 25/72 (34%), Positives = 35/72 (48%), Gaps = 4/72 (5%) Frame = +3 Query: 207 GVTGTLXDASSLFPAIVPP*WHSTWARWGFLTPFEFNNFQEQVMNVLEGHAAL----TLR 374 G G + AS+LF VPP GFLT F F++ + V+ G+ L TLR Sbjct: 1496 GGDGVILHASNLFRTSVPPVVSFNLGSLGFLTSHNFEGFRQDLRAVIHGNNTLGVYITLR 1555 Query: 375 SRLQCVVLRKSQ 410 RL+C + R + Sbjct: 1556 MRLRCEIFRNGK 1567 >01_07_0230 + 42170382-42170408,42170532-42170648,42171930-42172119, 42172250-42172369,42172448-42172740,42172872-42172966, 42173075-42173181,42173514-42173602,42173809-42173895, 42174053-42174077,42174659-42174966,42175352-42175657 Length = 587 Score = 39.1 bits (87), Expect = 0.002 Identities = 24/59 (40%), Positives = 37/59 (62%), Gaps = 2/59 (3%) Frame = +3 Query: 288 WGFLTP-FEFNN-FQEQVMNVLEGHAALTLRSRLQCVVLRKSQDDNKDKXKPTTILVLN 458 W +LT E + +++ + NVL G ++TLR+RLQC V+R + D + +P ILVLN Sbjct: 375 WNWLTAEMEASEQYRDCLDNVLNGPFSITLRNRLQCHVIRDAAKDELETEEP--ILVLN 431 >05_04_0161 + 18635635-18635788,18637117-18637295,18638032-18638145, 18638274-18638368,18638604-18638710,18639455-18639528, 18641170-18641400,18641892-18642197 Length = 419 Score = 29.9 bits (64), Expect = 1.0 Identities = 22/79 (27%), Positives = 36/79 (45%) Frame = +2 Query: 29 QLVHWLVHDKSMVVFVEAAVLDDTLLAEYGDFTSVKERLMTFRASTDDLTDKIDFIICLG 208 ++V WL ++ +FVE V + L+ E F ++ T L K+D I+ LG Sbjct: 178 EMVRWLKEHNNINIFVEPRVSKE-LVTEDSYFNFIQTWDNDEEMKT--LHTKVDLIVTLG 234 Query: 209 GDRDPXGC*LTFSSNRAAV 265 GD C + + S + V Sbjct: 235 GDGTVLWCHVIYDSAKNEV 253 >05_05_0165 + 22851863-22852566,22852811-22852964,22853112-22853261, 22853769-22853930,22854070-22854242,22854330-22854396, 22854556-22854722,22855216-22855374,22856187-22856276, 22856392-22856483,22856587-22856681,22857328-22857405, 22858364-22858459,22859132-22859206,22859290-22859381, 22859462-22859624,22859734-22859794,22860016-22860116, 22860567-22860614 Length = 908 Score = 29.5 bits (63), Expect = 1.4 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 119 PHTPQGVCHPKLPPRRTPPC 60 PH +C P+LPP R+P C Sbjct: 9 PHLRLDLCSPRLPPLRSPGC 28 >03_06_0074 - 31476094-31476215,31477803-31478238,31478438-31478485, 31478569-31479018,31479567-31479681,31480052-31480905 Length = 674 Score = 29.5 bits (63), Expect = 1.4 Identities = 15/28 (53%), Positives = 16/28 (57%) Frame = -2 Query: 149 SSDVPSPT*SPHTPQGVCHPKLPPRRTP 66 SS PSP SP P P LPPRR+P Sbjct: 26 SSSSPSP--SPSPPSSSRKPPLPPRRSP 51 >04_03_0972 + 21347212-21347284,21347966-21348009,21348153-21348237, 21348810-21349358,21350291-21350416,21350772-21350936, 21351243-21351310,21351529-21351618,21351740-21351830, 21352214-21352812 Length = 629 Score = 28.3 bits (60), Expect = 3.1 Identities = 11/42 (26%), Positives = 23/42 (54%) Frame = -3 Query: 277 VECHHGGTIAGKSELASXRVPVTPQAYDEVDLISEIVGASSE 152 V+C +G + S L + ++P TP D +++++V S+ Sbjct: 407 VQCSNGDSTTISSTLVNVKIPATPGYVDPCYVVNQVVTPKSD 448 >03_06_0004 + 30936670-30936726,30936858-30936905,30937045-30937080, 30937184-30937258,30937568-30937692,30937770-30937779, 30938125-30938296,30938547-30938665,30938868-30938978, 30939053-30939197,30939340-30939472,30939545-30939620, 30940141-30940206,30940308-30940415,30940750-30940857, 30940948-30941145,30941343-30941591 Length = 611 Score = 28.3 bits (60), Expect = 3.1 Identities = 15/28 (53%), Positives = 21/28 (75%) Frame = -3 Query: 151 SHQTFLHRRKVPILRKECVIQNCRLDEH 68 SHQ FLHR KV I+ +E V+ NC ++E+ Sbjct: 420 SHQ-FLHR-KVSIVSQEPVLFNCSIEEN 445 >05_04_0183 - 18849749-18850225,18850305-18850431,18851762-18853515 Length = 785 Score = 27.5 bits (58), Expect = 5.5 Identities = 13/19 (68%), Positives = 13/19 (68%), Gaps = 2/19 (10%) Frame = -2 Query: 305 GRQKTPTSPSGMP--SRRH 255 G QKTPTSP G P RRH Sbjct: 19 GGQKTPTSPRGAPGADRRH 37 >12_02_0792 - 23191120-23191313,23191419-23191775,23192027-23192108, 23192186-23193097,23193190-23193346,23193540-23193694, 23194667-23194819,23195334-23195627,23195711-23195896, 23196062-23196662,23196868-23196992,23197101-23197197, 23197299-23197411,23198129-23198233 Length = 1176 Score = 27.1 bits (57), Expect = 7.3 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%) Frame = +2 Query: 287 LGFSDALRVQQLSGASHERFRRTRGSNFK-VPFAMRSASEKSRRQ*RQXEADHDTGAE 457 +GF R+ + S ASH RR RG + + +P E + + ++D +TG E Sbjct: 716 MGFGILFRLDESSLASHLNERRVRGEDEEALPDVESQKLESNAELDGELDSDSETGKE 773 >06_02_0041 + 10889741-10890092,10890161-10890235,10891139-10892341, 10892970-10893253,10893343-10893459,10894126-10894388, 10894557-10894725,10894838-10895110,10895674-10895718, 10896472-10896591,10896926-10896987,10897296-10897318, 10897911-10898128 Length = 1067 Score = 27.1 bits (57), Expect = 7.3 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = -2 Query: 329 LLKVVELEGRQKTPTSPSGMPSRR 258 +L +EL+GR+ SP +PSRR Sbjct: 992 ILHCLELDGRESANKSPCRLPSRR 1015 >05_03_0117 + 8580270-8580677,8581541-8582328,8582412-8582663, 8582744-8582854,8582942-8583020,8583104-8583175, 8583253-8583420 Length = 625 Score = 27.1 bits (57), Expect = 7.3 Identities = 13/25 (52%), Positives = 13/25 (52%) Frame = -2 Query: 137 PSPT*SPHTPQGVCHPKLPPRRTPP 63 P PT P P G PKL P R PP Sbjct: 11 PQPTSPPARP-GPTEPKLAPSRAPP 34 >05_07_0280 - 28920864-28920971,28921076-28921175,28921267-28921394, 28922013-28922180,28922280-28922395,28922584-28922736, 28922904-28923047,28923401-28924133 Length = 549 Score = 26.6 bits (56), Expect = 9.6 Identities = 15/55 (27%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +2 Query: 53 DKSMVVFVEAAVLDDTLLA-EYGDFTSVKERLMTFRASTDDLTDKIDFIICLGGD 214 DK F+ L++ L + GD ++KE + D+ D I+++ +GGD Sbjct: 476 DKDHSGFITVDELEEALTKYDMGDEATIKEIIAEVDTDHDNRIDYIEYLENIGGD 530 >04_03_0091 - 11043023-11043090,11043458-11043566,11044431-11044577, 11044678-11044776,11044857-11044982,11045448-11045582, 11046391-11046468,11046553-11046678,11046828-11046968 Length = 342 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/39 (28%), Positives = 18/39 (46%) Frame = -3 Query: 199 YDEVDLISEIVGASSESHQTFLHRRKVPILRKECVIQNC 83 Y + I EI G ++ F H PIL + ++ +C Sbjct: 114 YKDRKRIPEITGGFEQNRDHFRHNDSRPILHNDTILASC 152 >03_05_0916 - 28762214-28762414,28763144-28763242,28763573-28763998, 28764259-28764501,28764706-28764927,28765392-28765721, 28767380-28767800,28768292-28768404,28769224-28769367, 28769439-28769570,28769802-28770013,28770983-28771505 Length = 1021 Score = 26.6 bits (56), Expect = 9.6 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -2 Query: 323 KVVELEGRQKTPTSPSGMPSRRHD 252 KVVE+EG SPSG S R D Sbjct: 853 KVVEIEGADDVRFSPSGTDSGRSD 876 >03_05_0543 - 25404630-25405408,25405461-25405605 Length = 307 Score = 26.6 bits (56), Expect = 9.6 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -2 Query: 137 PSPT*SPHTPQGVCHPKLPPRRTP 66 PSPT SP TP P+ PRR P Sbjct: 119 PSPTPSPVTPPPQQPPQPEPRRPP 142 >03_05_0340 + 23294044-23294166,23294395-23294640,23294907-23294945, 23295439-23295805,23295904-23296136,23296496-23296756 Length = 422 Score = 26.6 bits (56), Expect = 9.6 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +3 Query: 168 TISLIRSTSSYAWGVTGTLXDASSL 242 T+ L+R ++Y+WG TG SSL Sbjct: 214 TVHLLRVAAAYSWGGTGVDRAGSSL 238 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,372,551 Number of Sequences: 37544 Number of extensions: 250296 Number of successful extensions: 889 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 842 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 886 length of database: 14,793,348 effective HSP length: 76 effective length of database: 11,940,004 effective search space used: 907440304 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -