BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0121.Seq (459 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. 27 0.42 AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease pr... 23 6.8 >EF592176-1|ABQ95972.2| 661|Anopheles gambiae laccase-3 protein. Length = 661 Score = 26.6 bits (56), Expect = 0.42 Identities = 15/53 (28%), Positives = 25/53 (47%), Gaps = 3/53 (5%) Frame = -3 Query: 190 VDLISEIVGASSESHQTFLHRRKVPILRKECVIQNCRL---DEHHHAFVMNEP 41 VD+ + + G S+ H LH+R P + I C + + +AF+ EP Sbjct: 126 VDITNAMAGTSAAIHWHGLHQRATPYMDGVPFITQCPIGFGNTFRYAFLATEP 178 >AJ250916-1|CAB91840.1| 435|Anopheles gambiae serine protease protein. Length = 435 Score = 22.6 bits (46), Expect = 6.8 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 229 SXRVPVTPQAYDEVD 185 S R+P T +YD+VD Sbjct: 159 SVRLPATADSYDDVD 173 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 456,946 Number of Sequences: 2352 Number of extensions: 8544 Number of successful extensions: 21 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 20 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 21 length of database: 563,979 effective HSP length: 59 effective length of database: 425,211 effective search space used: 39544623 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -