BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0119.Seq (648 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_02_0032 + 10775031-10775520,10775661-10776246,10776333-107769... 32 0.45 06_03_1337 + 29434240-29434449,29434504-29434675,29435067-294351... 29 3.2 04_04_0141 + 23079516-23079925,23080006-23080084,23080204-230803... 29 3.2 09_04_0256 + 16148820-16148998,16149547-16150241,16150317-161505... 28 5.6 07_03_1652 - 28409097-28409165,28409788-28409911,28410317-284105... 28 5.6 07_03_0014 - 12428713-12428860,12429340-12429580,12429664-124303... 28 5.6 05_01_0595 + 5344721-5345249,5349183-5349264,5349813-5350507,535... 28 5.6 03_03_0039 - 13986844-13986907,13987219-13987273,13987492-139876... 28 5.6 02_05_1149 + 34471730-34471790,34471975-34472056,34472605-344732... 28 5.6 01_05_0117 - 18300157-18301106,18301149-18301543,18302592-183026... 28 5.6 01_01_1009 + 7992040-7992287,7992747-7993144,7993301-7993441,799... 28 5.6 11_03_0135 - 10547460-10547558,10547926-10548086,10548183-105483... 28 7.4 10_03_0013 + 7045552-7045686,7045868-7046083 28 7.4 06_02_0186 + 12787866-12788055,12788575-12788642,12788864-127890... 27 9.7 02_04_0360 + 22353057-22353691,22354716-22355144,22355233-223553... 27 9.7 >06_02_0032 + 10775031-10775520,10775661-10776246,10776333-10776973, 10777270-10777973 Length = 806 Score = 31.9 bits (69), Expect = 0.45 Identities = 26/83 (31%), Positives = 37/83 (44%), Gaps = 3/83 (3%) Frame = -1 Query: 636 ARSTKAEEGTCQKS---QEETHSEQRGRTRSDGATTSNDNDKQYDSTTRTTVAPNIRKRS 466 A S EE QKS Q+E EQ +T T S D K+ D TT++ N + Sbjct: 577 ANSQDEEERVVQKSPPAQDEDVIEQETQTLKPSETMSADEIKEDDRTTKSADIENAGEAK 636 Query: 465 *DLSNQIRLKMKILPPNPKSSQK 397 + SN+ K K +S++K Sbjct: 637 NNTSNETNEKEKQERAATESNEK 659 >06_03_1337 + 29434240-29434449,29434504-29434675,29435067-29435152, 29435351-29435759,29435893-29436020,29436094-29436153, 29436501-29436650,29436771-29436926,29437045-29437182, 29437270-29437343,29437752-29437853,29437951-29438191, 29438651-29438668 Length = 647 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 2/50 (4%) Frame = -1 Query: 627 TKAEEGTCQKSQEETHSEQRGRTRSDGATTSNDNDKQY--DSTTRTTVAP 484 +K E G+ + + + +R DG N ND++ DS RTTV+P Sbjct: 545 SKGERGSPLQRKHASLPRERVGVSKDGYNQQNTNDQERSADSVARTTVSP 594 >04_04_0141 + 23079516-23079925,23080006-23080084,23080204-23080326, 23081655-23081771,23081886-23081945 Length = 262 Score = 29.1 bits (62), Expect = 3.2 Identities = 18/61 (29%), Positives = 28/61 (45%) Frame = +2 Query: 62 KNESTKRGTAITIFKCIHKLKTTQSHKVMQGLLKLMFPFVIPRSYHHGSRCRCLRNCFDY 241 K ES +T+ K T+ K+ G+LKL+ ++P S S+ L+ DY Sbjct: 76 KEESRGNEDRVTLIKDYRGKIETELTKICDGILKLLESHLVPSSTAPESKVFYLKMKGDY 135 Query: 242 Y 244 Y Sbjct: 136 Y 136 >09_04_0256 + 16148820-16148998,16149547-16150241,16150317-16150573, 16150668-16151349,16151423-16151626,16151715-16152449, 16152533-16152698,16153253-16153400 Length = 1021 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -1 Query: 594 QEETHSEQRGRTRSDGATTSNDNDKQYDSTTRTTVAPNIRKR 469 Q + HS + D + D D S+ RTT+AP +R++ Sbjct: 907 QSDHHSPVQFTGEGDFTHATQDQDHGAPSSQRTTIAPGVRQQ 948 >07_03_1652 - 28409097-28409165,28409788-28409911,28410317-28410557, 28410641-28411375,28411464-28411667,28411741-28412422, 28412517-28412773,28412849-28413543,28414003-28414250 Length = 1084 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -1 Query: 594 QEETHSEQRGRTRSDGATTSNDNDKQYDSTTRTTVAPNIRKR 469 Q + HS + D + D D S+ RTT+AP +R++ Sbjct: 930 QSDHHSPVQFTGEGDFTHATQDQDHGAPSSQRTTIAPGVRQQ 971 >07_03_0014 - 12428713-12428860,12429340-12429580,12429664-12430398, 12430487-12430690,12430764-12431445,12431540-12431796, 12431872-12432566,12433012-12433172,12434039-12434383, 12434399-12434631,12434656-12434740 Length = 1261 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -1 Query: 594 QEETHSEQRGRTRSDGATTSNDNDKQYDSTTRTTVAPNIRKR 469 Q + HS + D + D D S+ RTT+AP +R++ Sbjct: 1122 QSDHHSPVQFTGEGDFTHATQDQDHGAPSSQRTTIAPGVRQQ 1163 >05_01_0595 + 5344721-5345249,5349183-5349264,5349813-5350507, 5350583-5350839,5350934-5351615,5351689-5351892, 5351981-5352715,5352799-5353181 Length = 1188 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -1 Query: 594 QEETHSEQRGRTRSDGATTSNDNDKQYDSTTRTTVAPNIRKR 469 Q + HS + D + D D S+ RTT+AP +R++ Sbjct: 1051 QSDHHSPVQFTGEGDFTHATQDQDHGAPSSQRTTIAPGVRQQ 1092 >03_03_0039 - 13986844-13986907,13987219-13987273,13987492-13987606, 13987652-13987774,13987962-13988015,13988352-13988411, 13988522-13988584,13988790-13988863,13989177-13989261, 13989376-13989456,13989764-13989856,13990275-13990339, 13990407-13990482,13990570-13990635,13991094-13991153, 13991233-13991322,13991755-13991817,13992502-13992625, 13993031-13993271,13993355-13993624,13993715-13994089, 13994178-13994381,13994455-13995136,13995231-13995279, 13995362-13995488,13995564-13996258,13996718-13996965 Length = 1433 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -1 Query: 594 QEETHSEQRGRTRSDGATTSNDNDKQYDSTTRTTVAPNIRKR 469 Q + HS + D + D D S+ RTT+AP +R++ Sbjct: 873 QSDHHSPVQFTGEGDFTHATQDQDHGAPSSQRTTIAPGVRQQ 914 >02_05_1149 + 34471730-34471790,34471975-34472056,34472605-34473299, 34473375-34473631,34473726-34474407,34474481-34474684, 34474773-34474903,34475068-34475263,34475347-34475587, 34476067-34476214 Length = 898 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -1 Query: 594 QEETHSEQRGRTRSDGATTSNDNDKQYDSTTRTTVAPNIRKR 469 Q + HS + D + D D S+ RTT+AP +R++ Sbjct: 759 QSDHHSPVQFTGEGDFTHATQDQDHGAPSSQRTTIAPGVRQQ 800 >01_05_0117 - 18300157-18301106,18301149-18301543,18302592-18302681, 18303723-18303836,18303903-18304046,18316147-18316312, 18316396-18317130,18317219-18317422,18317496-18318177, 18318272-18318528,18318604-18319298,18319345-18319382, 18319847-18319928,18320018-18320112,18320443-18320526, 18320601-18320891,18321521-18321853,18321948-18322150, 18322243-18322399,18322482-18322585,18322675-18322835, 18323511-18323824,18324317-18324589,18324666-18324967, 18325459-18325549,18326140-18326190,18326700-18326768, 18326926-18327017,18327082-18327148,18328582-18328746, 18329027-18329103,18329572-18329766,18330208-18330275, 18331081-18331172,18331399-18331522,18331608-18331705, 18332384-18332997,18333620-18333626 Length = 2892 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -1 Query: 594 QEETHSEQRGRTRSDGATTSNDNDKQYDSTTRTTVAPNIRKR 469 Q + HS + D + D D S+ RTT+AP +R++ Sbjct: 2263 QSDHHSPVQFTGEGDFTHATQDQDHGAPSSQRTTIAPGVRQQ 2304 >01_01_1009 + 7992040-7992287,7992747-7993144,7993301-7993441, 7993517-7993773,7993868-7994169,7994342-7994580, 7994654-7994857,7994946-7995680,7995764-7996155 Length = 971 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -1 Query: 594 QEETHSEQRGRTRSDGATTSNDNDKQYDSTTRTTVAPNIRKR 469 Q + HS + D + D D S+ RTT+AP +R++ Sbjct: 831 QSDHHSPVQFTGEGDFTHATQDQDHGAPSSQRTTIAPGVRQQ 872 >11_03_0135 - 10547460-10547558,10547926-10548086,10548183-10548306, 10548566-10548729,10549803-10549883,10549973-10550097, 10550200-10550430,10550566-10550588,10551055-10551539, 10551678-10552075,10552903-10552988,10553120-10553397, 10553494-10553714,10553927-10554018,10554148-10554213, 10555855-10556022 Length = 933 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/45 (35%), Positives = 24/45 (53%), Gaps = 2/45 (4%) Frame = -1 Query: 636 ARSTK--AEEGTCQKSQEETHSEQRGRTRSDGATTSNDNDKQYDS 508 ++STK AEEG T E+ GR+ G+ +N N++Q S Sbjct: 175 SKSTKEDAEEGIVPSGCTSTGKEEDGRSCIGGSEAANKNEEQTSS 219 >10_03_0013 + 7045552-7045686,7045868-7046083 Length = 116 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/43 (37%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -2 Query: 629 LQKPKREHVRSHKKKHIQSN-EEEQDLTEQLRPTIMISNTIRR 504 L+KPK + KK++++ EEE+ L +LR I NT R+ Sbjct: 24 LEKPKPKPKAKKKKRNVEKTVEEEEQLNHRLR-LAAIENTKRK 65 >06_02_0186 + 12787866-12788055,12788575-12788642,12788864-12789007, 12789112-12789268,12789344-12789366,12789487-12789495, 12789694-12790108,12790449-12790652,12790741-12791201, 12791206-12791476,12791560-12791951 Length = 777 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = -1 Query: 594 QEETHSEQRGRTRSDGATTSNDNDKQYDSTTRTTVAPNIRKR 469 Q + HS + + D + D D S+ RTT+AP R++ Sbjct: 637 QSDHHSPIQFTGKGDFTRATQDRDHGAPSSQRTTIAPGARQQ 678 >02_04_0360 + 22353057-22353691,22354716-22355144,22355233-22355311, 22355472-22355594,22356256-22356372,22356636-22356833 Length = 526 Score = 27.5 bits (58), Expect = 9.7 Identities = 18/61 (29%), Positives = 27/61 (44%) Frame = +2 Query: 62 KNESTKRGTAITIFKCIHKLKTTQSHKVMQGLLKLMFPFVIPRSYHHGSRCRCLRNCFDY 241 K ES T+ K T+ K+ G+LKL+ ++P S S+ L+ DY Sbjct: 294 KEESRGNEDRCTLIKEYRGKIETELSKICDGILKLLDSHLVPSSTAPESKVFYLKMKGDY 353 Query: 242 Y 244 Y Sbjct: 354 Y 354 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,569,549 Number of Sequences: 37544 Number of extensions: 230799 Number of successful extensions: 781 Number of sequences better than 10.0: 15 Number of HSP's better than 10.0 without gapping: 749 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 781 length of database: 14,793,348 effective HSP length: 79 effective length of database: 11,827,372 effective search space used: 1608522592 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -