BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0116.Seq (598 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0389 - 13409848-13409964,13410049-13410114,13410209-134103... 54 9e-08 01_07_0097 + 41070877-41070942,41071039-41071104,41071189-41071305 53 2e-07 03_05_0322 - 23094767-23094873,23094956-23095199,23095288-23095479 32 0.40 03_05_0944 + 29046793-29046922,29048091-29048464,29048556-290486... 29 2.1 10_08_0415 - 17761594-17762382 28 4.9 05_04_0373 + 20732358-20732675,20733555-20734440,20734523-20735625 28 4.9 10_08_0975 - 21978642-21979520 28 6.5 02_04_0613 + 24392238-24393550,24394585-24394687,24395153-24395257 27 8.6 >05_03_0389 - 13409848-13409964,13410049-13410114,13410209-13410325, 13410822-13410893,13410979-13411258,13411528-13411730, 13412230-13412316,13412705-13412758,13413042-13413221, 13414402-13414576,13414628-13414918,13414923-13415344 Length = 687 Score = 54.0 bits (124), Expect = 9e-08 Identities = 23/53 (43%), Positives = 34/53 (64%) Frame = -2 Query: 513 FLKWCSEPELDDRRQMTIKAIGMFSMLAAVVYYYKRHKWSTLKSRKLAYKPVS 355 FL W +EPE+++R+ M +K I + S+ YY+R +WS LKSRKL V+ Sbjct: 635 FLSWAAEPEMEERKLMGVKWIFLLSLALLQAAYYRRMRWSVLKSRKLVLDVVN 687 Score = 37.1 bits (82), Expect = 0.011 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -3 Query: 593 KFYLTKQLEYSDGTPATASQLAKDVATF*NGAQNP 489 K + +EY DGTPAT +Q+ KDV +F + A P Sbjct: 608 KMLIDGAVEYEDGTPATEAQMGKDVVSFLSWAAEP 642 >01_07_0097 + 41070877-41070942,41071039-41071104,41071189-41071305 Length = 82 Score = 53.2 bits (122), Expect = 2e-07 Identities = 23/53 (43%), Positives = 33/53 (62%) Frame = -2 Query: 513 FLKWCSEPELDDRRQMTIKAIGMFSMLAAVVYYYKRHKWSTLKSRKLAYKPVS 355 FL W +EPE+++R+ M +K I + S+ YY+R KWS KSRKL V+ Sbjct: 30 FLSWAAEPEMEERKLMGVKWIFLLSLALLQAAYYRRMKWSVYKSRKLVLDVVN 82 Score = 37.1 bits (82), Expect = 0.011 Identities = 16/35 (45%), Positives = 22/35 (62%) Frame = -3 Query: 593 KFYLTKQLEYSDGTPATASQLAKDVATF*NGAQNP 489 K + +EY DGTPAT +Q+ KDV +F + A P Sbjct: 3 KMLIDGAVEYEDGTPATEAQMGKDVVSFLSWAAEP 37 >03_05_0322 - 23094767-23094873,23094956-23095199,23095288-23095479 Length = 180 Score = 31.9 bits (69), Expect = 0.40 Identities = 10/18 (55%), Positives = 11/18 (61%) Frame = -2 Query: 543 CVTARQGCCDFLKWCSEP 490 CV AR GCCD+ W P Sbjct: 60 CVNARSGCCDYFAWVDGP 77 >03_05_0944 + 29046793-29046922,29048091-29048464,29048556-29048687, 29048829-29049210,29049370-29049513,29049593-29049777, 29049925-29050051,29050603-29050676,29051071-29051147, 29051256-29051292,29051453-29051619,29051800-29051983, 29052053-29052130,29052451-29052570,29052648-29052707, 29053057-29053179,29053848-29053941,29054019-29054197, 29054737-29055039,29055373-29055474,29055553-29055693, 29055831-29055995,29056168-29056344,29056432-29056554, 29057787-29057867,29057983-29058099,29058214-29058386, 29058846-29058923,29058994-29059141,29059755-29059877, 29060015-29060071,29060145-29060255,29060382-29060573, 29060690-29060863,29061263-29061373,29061462-29061531, 29061734-29061812,29061898-29062000,29062086-29062256, 29062348-29062470,29062548-29062661,29062935-29063041, 29063117-29063168,29063245-29063351,29063589-29063703, 29063819-29063929,29064016-29064153,29064230-29064352, 29064535-29064606,29064774-29064886,29066780-29067110, 29067199-29067381,29068669-29068863,29068943-29069110, 29069208-29069340,29069511-29069595,29069726-29069765 Length = 2591 Score = 29.5 bits (63), Expect = 2.1 Identities = 17/39 (43%), Positives = 20/39 (51%), Gaps = 2/39 (5%) Frame = -2 Query: 558 RHAGDCVT--ARQGCCDFLKWCSEPELDDRRQMTIKAIG 448 RHAG V+ R CD LK + + DD R KAIG Sbjct: 2343 RHAGKSVSPVVRSRGCDLLKDLLQADADDVRSSAAKAIG 2381 >10_08_0415 - 17761594-17762382 Length = 262 Score = 28.3 bits (60), Expect = 4.9 Identities = 15/38 (39%), Positives = 22/38 (57%) Frame = -3 Query: 560 DGTPATASQLAKDVATF*NGAQNPNWTTVGR*PSKLSA 447 DG+ + S LA+ VA + G P W +G PS+L+A Sbjct: 42 DGSDISTSDLARVVARWGVGRGRPTWALMGS-PSQLAA 78 >05_04_0373 + 20732358-20732675,20733555-20734440,20734523-20735625 Length = 768 Score = 28.3 bits (60), Expect = 4.9 Identities = 14/35 (40%), Positives = 18/35 (51%) Frame = +1 Query: 364 LVGELSRLERGPLVPLVVVDNGGKHGEHADSFDGH 468 + E +R + P V VVV+ G GE AD GH Sbjct: 15 IADEAARRDGSPPVDAVVVEGAGTSGEDADWPSGH 49 >10_08_0975 - 21978642-21979520 Length = 292 Score = 27.9 bits (59), Expect = 6.5 Identities = 13/35 (37%), Positives = 20/35 (57%) Frame = +2 Query: 479 SSSSGSEHHFRKSQHPWRAVTQSPACRHCTQAASS 583 SSS S F +S P+ A +S AC + + ++SS Sbjct: 46 SSSRASSSLFARSVSPYAAARRSDACAYASSSSSS 80 >02_04_0613 + 24392238-24393550,24394585-24394687,24395153-24395257 Length = 506 Score = 27.5 bits (58), Expect = 8.6 Identities = 19/80 (23%), Positives = 32/80 (40%) Frame = +1 Query: 250 NYLIINN*HVTVPIEKKNLSKTFVLLLVSCWRLFLRNGLVGELSRLERGPLVPLVVVDNG 429 NYL+I T+ + KN++ T+ + C L + P V +V+ + Sbjct: 59 NYLVIQRFKKTITSDPKNITATWTGHDI-CGNTTYLGFYCAALPGRTKKPTVTVVIFNGY 117 Query: 430 GKHGEHADSFDGHLPTVVQF 489 G + F HLP + F Sbjct: 118 GLRAPKLEGFIDHLPDLALF 137 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,256,226 Number of Sequences: 37544 Number of extensions: 300740 Number of successful extensions: 695 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 682 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 695 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1423789920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -