BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0116.Seq (598 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprol... 25 1.9 DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosylt... 25 2.5 EF426244-1|ABO26487.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426243-1|ABO26486.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426242-1|ABO26485.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426241-1|ABO26484.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426240-1|ABO26483.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426239-1|ABO26482.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426238-1|ABO26481.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426237-1|ABO26480.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426236-1|ABO26479.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426235-1|ABO26478.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426234-1|ABO26477.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426233-1|ABO26476.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426232-1|ABO26475.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426231-1|ABO26474.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426230-1|ABO26473.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426229-1|ABO26472.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426228-1|ABO26471.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426227-1|ABO26470.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426226-1|ABO26469.1| 64|Anopheles gambiae unknown protein. 23 9.9 EF426225-1|ABO26468.1| 64|Anopheles gambiae unknown protein. 23 9.9 >AJ441131-8|CAD29637.1| 756|Anopheles gambiae putative 5-oxoprolinase protein. Length = 756 Score = 25.0 bits (52), Expect = 1.9 Identities = 11/24 (45%), Positives = 13/24 (54%) Frame = +2 Query: 524 PWRAVTQSPACRHCTQAASSNRTC 595 P RA+TQ+P RH A R C Sbjct: 483 PIRALTQAPRVRHVAPRAGLLRDC 506 >DQ139945-1|ABA29466.1| 399|Anopheles gambiae protein O-fucosyltransferase 1 protein. Length = 399 Score = 24.6 bits (51), Expect = 2.5 Identities = 13/36 (36%), Positives = 23/36 (63%), Gaps = 1/36 (2%) Frame = +3 Query: 468 SADGRPVRVLSTISESRNILGEL*RS-RRRAVTVLK 572 +A P+R + S+S ++LGEL + +R VTV++ Sbjct: 296 AAPDNPIRAVFVASDSNHMLGELNDALKRMDVTVVR 331 >EF426244-1|ABO26487.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426243-1|ABO26486.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426242-1|ABO26485.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426241-1|ABO26484.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426240-1|ABO26483.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426239-1|ABO26482.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426238-1|ABO26481.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426237-1|ABO26480.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426236-1|ABO26479.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426235-1|ABO26478.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426234-1|ABO26477.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426233-1|ABO26476.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426232-1|ABO26475.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426231-1|ABO26474.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426230-1|ABO26473.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426229-1|ABO26472.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426228-1|ABO26471.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426227-1|ABO26470.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426226-1|ABO26469.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 >EF426225-1|ABO26468.1| 64|Anopheles gambiae unknown protein. Length = 64 Score = 22.6 bits (46), Expect = 9.9 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = +3 Query: 81 DHLTLQFDCATASQWQNA 134 +H+T +FD S W NA Sbjct: 38 EHITGEFDYPDPSSWTNA 55 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 604,268 Number of Sequences: 2352 Number of extensions: 11412 Number of successful extensions: 38 Number of sequences better than 10.0: 22 Number of HSP's better than 10.0 without gapping: 38 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 38 length of database: 563,979 effective HSP length: 61 effective length of database: 420,507 effective search space used: 57609459 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -