SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= msgV0114.Seq
         (648 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.      24   1.2  
AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.      24   1.2  
AM292368-1|CAL23180.2|  387|Tribolium castaneum gustatory recept...    21   6.6  
AM292347-1|CAL23159.2|  387|Tribolium castaneum gustatory recept...    21   6.6  
AM292327-1|CAL23139.2|  387|Tribolium castaneum gustatory recept...    21   6.6  

>AY800247-1|AAV66724.1|  790|Tribolium castaneum pangolin protein.
          Length = 790

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 3/33 (9%)
 Frame = -3

Query: 415 QPLSTWYLPSLYV*SPS---RNSHPSVVLLSVT 326
           Q  ++W+ PS+Y  SP    R+ +PS + +S +
Sbjct: 183 QVAASWHTPSMYPLSPGAGFRSPYPSALPISTS 215


>AY800246-1|AAV66723.1|  682|Tribolium castaneum pangolin protein.
          Length = 682

 Score = 23.8 bits (49), Expect = 1.2
 Identities = 11/33 (33%), Positives = 20/33 (60%), Gaps = 3/33 (9%)
 Frame = -3

Query: 415 QPLSTWYLPSLYV*SPS---RNSHPSVVLLSVT 326
           Q  ++W+ PS+Y  SP    R+ +PS + +S +
Sbjct: 75  QVAASWHTPSMYPLSPGAGFRSPYPSALPISTS 107


>AM292368-1|CAL23180.2|  387|Tribolium castaneum gustatory receptor
           candidate 47 protein.
          Length = 387

 Score = 21.4 bits (43), Expect = 6.6
 Identities = 7/10 (70%), Positives = 9/10 (90%)
 Frame = -3

Query: 202 TIFHTTAILH 173
           T++HTTA LH
Sbjct: 155 TLYHTTAYLH 164


>AM292347-1|CAL23159.2|  387|Tribolium castaneum gustatory receptor
           candidate 26 protein.
          Length = 387

 Score = 21.4 bits (43), Expect = 6.6
 Identities = 7/10 (70%), Positives = 9/10 (90%)
 Frame = -3

Query: 202 TIFHTTAILH 173
           T++HTTA LH
Sbjct: 155 TLYHTTAYLH 164


>AM292327-1|CAL23139.2|  387|Tribolium castaneum gustatory receptor
           candidate 6 protein.
          Length = 387

 Score = 21.4 bits (43), Expect = 6.6
 Identities = 7/10 (70%), Positives = 9/10 (90%)
 Frame = -3

Query: 202 TIFHTTAILH 173
           T++HTTA LH
Sbjct: 155 TLYHTTAYLH 164


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 152,680
Number of Sequences: 336
Number of extensions: 3186
Number of successful extensions: 9
Number of sequences better than 10.0: 5
Number of HSP's better than 10.0 without gapping: 9
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 9
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 16656800
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -