BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0114.Seq (648 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine pr... 24 4.8 AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1... 23 6.3 AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1... 23 6.3 AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1... 23 6.3 AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative different... 23 6.3 AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant r... 23 6.3 Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like pr... 23 8.3 Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. 23 8.3 AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 pr... 23 8.3 AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcript... 23 8.3 >AJ276428-1|CAB81934.1| 1322|Anopheles gambiae adhesive serine protease protein. Length = 1322 Score = 23.8 bits (49), Expect = 4.8 Identities = 10/19 (52%), Positives = 12/19 (63%) Frame = -3 Query: 424 LEMQPLSTWYLPSLYV*SP 368 LE PL++W LP YV P Sbjct: 632 LEPVPLASWQLPPPYVTEP 650 >AY334007-1|AAR01132.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.4 bits (48), Expect = 6.3 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = -3 Query: 154 KEKRATNSFLFYIFYKACNVTLFYNLYKVIHNISETFCYDCKLKC 20 K+ + N +F VTL Y L K +NI+ KL C Sbjct: 35 KDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNC 79 >AY334006-1|AAR01131.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.4 bits (48), Expect = 6.3 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = -3 Query: 154 KEKRATNSFLFYIFYKACNVTLFYNLYKVIHNISETFCYDCKLKC 20 K+ + N +F VTL Y L K +NI+ KL C Sbjct: 35 KDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNC 79 >AY334005-1|AAR01130.1| 202|Anopheles gambiae odorant receptor 1 protein. Length = 202 Score = 23.4 bits (48), Expect = 6.3 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = -3 Query: 154 KEKRATNSFLFYIFYKACNVTLFYNLYKVIHNISETFCYDCKLKC 20 K+ + N +F VTL Y L K +NI+ KL C Sbjct: 35 KDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNC 79 >AJ439398-8|CAD28131.1| 1283|Anopheles gambiae putative differentiation regulator protein. Length = 1283 Score = 23.4 bits (48), Expect = 6.3 Identities = 10/20 (50%), Positives = 14/20 (70%) Frame = +1 Query: 586 AVKSAAPLGGLFLESPAHNH 645 AV S++P GG L SP+ +H Sbjct: 702 AVVSSSPTGGHHLASPSPHH 721 >AF364130-1|AAL35506.1| 417|Anopheles gambiae putative odorant receptor Or1 protein. Length = 417 Score = 23.4 bits (48), Expect = 6.3 Identities = 14/45 (31%), Positives = 19/45 (42%) Frame = -3 Query: 154 KEKRATNSFLFYIFYKACNVTLFYNLYKVIHNISETFCYDCKLKC 20 K+ + N +F VTL Y L K +NI+ KL C Sbjct: 69 KDVKDINDIANALFVLMTQVTLIYKLEKFNYNIARIQACLRKLNC 113 >Z32645-2|CAA83568.1| 259|Anopheles gambiae chymotrypsin-like protease ANCHYM1 protein. Length = 259 Score = 23.0 bits (47), Expect = 8.3 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -2 Query: 554 NLKRLHTSLGLPHCPLACKFAEIKEKVD 471 NL R H +GL +F+E+ + V+ Sbjct: 112 NLPRFHNDIGLVRLEQPVQFSELVQSVE 139 >Z18887-1|CAA79325.1| 259|Anopheles gambiae chymotrypsin 1 protein. Length = 259 Score = 23.0 bits (47), Expect = 8.3 Identities = 9/28 (32%), Positives = 15/28 (53%) Frame = -2 Query: 554 NLKRLHTSLGLPHCPLACKFAEIKEKVD 471 NL R H +GL +F+E+ + V+ Sbjct: 112 NLPRFHNDIGLVRLEQPVQFSELVQSVE 139 >AY028783-1|AAK32957.1| 499|Anopheles gambiae cytochrome P450 protein. Length = 499 Score = 23.0 bits (47), Expect = 8.3 Identities = 10/25 (40%), Positives = 14/25 (56%) Frame = -3 Query: 142 ATNSFLFYIFYKACNVTLFYNLYKV 68 A FLF Y+ +T FY LY++ Sbjct: 291 AAQVFLFVAAYETNAITTFYCLYEL 315 >AB090820-2|BAC57916.1| 1222|Anopheles gambiae reverse transcriptase protein. Length = 1222 Score = 23.0 bits (47), Expect = 8.3 Identities = 10/29 (34%), Positives = 12/29 (41%) Frame = +1 Query: 280 LKLTALMTPTATVCLMSRTAKRPRGGNSW 366 L L + A VCLM PR +W Sbjct: 17 LALNTMRVERADVCLMVELHSVPRNNGNW 45 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 672,268 Number of Sequences: 2352 Number of extensions: 13714 Number of successful extensions: 55 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 41 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 55 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 63977715 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -