BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0113.Seq (598 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) 63 2e-10 SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) 60 1e-09 SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 49 2e-06 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 2e-06 SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 4e-06 SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) 48 8e-06 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 8e-06 SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) 47 1e-05 SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) 47 1e-05 SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) 46 2e-05 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 2e-05 SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) 46 3e-05 SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 3e-05 SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_7630| Best HMM Match : CAT (HMM E-Value=0) 45 4e-05 SB_4868| Best HMM Match : BA14K (HMM E-Value=10) 45 4e-05 SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) 45 4e-05 SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) 45 4e-05 SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 4e-05 SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 5e-05 SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 7e-05 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 44 9e-05 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 9e-05 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 44 9e-05 SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 44 1e-04 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 1e-04 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 43 2e-04 SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 43 2e-04 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 43 2e-04 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 2e-04 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 42 3e-04 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 3e-04 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 42 4e-04 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 42 4e-04 SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 42 4e-04 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 42 5e-04 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 42 5e-04 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 42 5e-04 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) 42 5e-04 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 41 7e-04 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 41 7e-04 SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) 41 7e-04 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 41 7e-04 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 41 7e-04 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 41 7e-04 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 41 7e-04 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) 41 7e-04 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 41 7e-04 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 41 7e-04 SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) 41 7e-04 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) 41 7e-04 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 41 7e-04 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 41 7e-04 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 41 7e-04 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 41 7e-04 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 41 7e-04 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 41 7e-04 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 41 7e-04 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) 41 7e-04 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 41 7e-04 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) 41 7e-04 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 41 7e-04 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 41 7e-04 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 41 7e-04 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 41 7e-04 SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 41 7e-04 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) 41 7e-04 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 41 7e-04 SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) 41 7e-04 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 41 7e-04 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 41 7e-04 SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 41 7e-04 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 41 7e-04 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 41 7e-04 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 41 7e-04 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 41 7e-04 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56358| Best HMM Match : Fork_head (HMM E-Value=1.2e-30) 41 7e-04 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56058| Best HMM Match : Phasin (HMM E-Value=2.7) 41 7e-04 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 41 7e-04 SB_55182| Best HMM Match : T4_deiodinase (HMM E-Value=0) 41 7e-04 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 41 7e-04 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 41 7e-04 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 41 7e-04 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 41 7e-04 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_52523| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 41 7e-04 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_48632| Best HMM Match : DUF265 (HMM E-Value=7.6e-22) 41 7e-04 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 41 7e-04 SB_46830| Best HMM Match : Succ_DH_flav_C (HMM E-Value=3.2e-37) 41 7e-04 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 41 7e-04 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 41 7e-04 SB_42128| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 41 7e-04 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 41 7e-04 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40139| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_40004| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39849| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39391| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 41 7e-04 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_37693| Best HMM Match : PHD (HMM E-Value=8.7e-35) 41 7e-04 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 41 7e-04 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34424| Best HMM Match : RNase_U2 (HMM E-Value=7.5) 41 7e-04 SB_34216| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_34007| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33833| Best HMM Match : DUF947 (HMM E-Value=0.2) 41 7e-04 SB_33422| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_33231| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_32900| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_32024| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_31980| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_31865| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_31481| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_31350| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_31293| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_30835| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_30699| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_30521| Best HMM Match : DUF333 (HMM E-Value=9.4) 41 7e-04 SB_30479| Best HMM Match : WD40 (HMM E-Value=1.1e-06) 41 7e-04 SB_30218| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_29851| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_29553| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_29464| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_29409| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_29145| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_28808| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_28480| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_26038| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_25820| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_25742| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_25673| Best HMM Match : MFS_1 (HMM E-Value=0.18) 41 7e-04 SB_25630| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_24724| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_24684| Best HMM Match : Phage_rep_O (HMM E-Value=2.3) 41 7e-04 SB_24127| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_24102| Best HMM Match : DUF753 (HMM E-Value=9.4) 41 7e-04 SB_23875| Best HMM Match : Porin_3 (HMM E-Value=3.22299e-44) 41 7e-04 SB_23282| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_22993| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_22914| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_21520| Best HMM Match : Trypsin (HMM E-Value=0) 41 7e-04 SB_21177| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_20904| Best HMM Match : Filament_head (HMM E-Value=10) 41 7e-04 SB_20313| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_20277| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_20097| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_19009| Best HMM Match : Sperm_Ag_HE2 (HMM E-Value=2.3) 41 7e-04 SB_18235| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_17919| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_17265| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_17049| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_16846| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_16672| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_16494| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_16270| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_16198| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_16182| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_15539| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_14857| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_14581| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_14087| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_13215| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_12828| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_12580| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_12518| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_12140| Best HMM Match : ATP-synt_F (HMM E-Value=0.21) 41 7e-04 SB_11401| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_11209| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_11018| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_10984| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_10689| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_10523| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_10150| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_10099| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.6e-17) 41 7e-04 SB_9428| Best HMM Match : Vicilin_N (HMM E-Value=4.2) 41 7e-04 SB_9250| Best HMM Match : BAG (HMM E-Value=6.2) 41 7e-04 SB_9090| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_8817| Best HMM Match : I-set (HMM E-Value=0) 41 7e-04 SB_8429| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_7590| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_7267| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_6263| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_5632| Best HMM Match : XRN_N (HMM E-Value=3.9) 41 7e-04 SB_5073| Best HMM Match : Rhomboid (HMM E-Value=3.3) 41 7e-04 SB_4702| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_4674| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_4528| Best HMM Match : Antistasin (HMM E-Value=8.4) 41 7e-04 SB_4508| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_4402| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_4342| Best HMM Match : KA1 (HMM E-Value=0.53) 41 7e-04 SB_2432| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_2348| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_2263| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_1977| Best HMM Match : Filament_head (HMM E-Value=4.2) 41 7e-04 SB_1945| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_1808| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_1403| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_1283| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_1210| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_1178| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_938| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_758| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_501| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_357| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 7e-04 SB_56096| Best HMM Match : fn3 (HMM E-Value=1.3e-24) 41 9e-04 SB_47448| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 9e-04 SB_14547| Best HMM Match : UCR_TM (HMM E-Value=2.7) 40 0.001 SB_9618| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 40 0.002 SB_17253| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 40 0.002 SB_52908| Best HMM Match : CAT (HMM E-Value=9.7e-07) 40 0.002 SB_19964| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_2434| Best HMM Match : Vicilin_N (HMM E-Value=0.01) 40 0.002 SB_343| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 40 0.002 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 40 0.002 SB_19218| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 40 0.002 SB_47076| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_36396| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_24747| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_11036| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_59793| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59725| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59550| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59504| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59286| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58987| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58768| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58651| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58615| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58535| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 39 0.003 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57634| Best HMM Match : EGF_2 (HMM E-Value=0.0014) 39 0.003 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57371| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57287| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 39 0.003 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57193| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 >SB_28728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 62.9 bits (146), Expect = 2e-10 Identities = 26/30 (86%), Positives = 27/30 (90%) Frame = +3 Query: 507 PIVSRITIHWPSFLQRXDWENPGVTQLNRL 596 PIVSRITIHWPSF +R DWENPGV QLNRL Sbjct: 20 PIVSRITIHWPSFYKRRDWENPGVNQLNRL 49 >SB_36408| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 458 Score = 60.1 bits (139), Expect = 1e-09 Identities = 25/28 (89%), Positives = 26/28 (92%) Frame = +3 Query: 513 VSRITIHWPSFLQRXDWENPGVTQLNRL 596 +SRITIHWPS LQR DWENPGVTQLNRL Sbjct: 277 LSRITIHWPSVLQRRDWENPGVTQLNRL 304 >SB_11515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 52.4 bits (120), Expect = 3e-07 Identities = 22/27 (81%), Positives = 22/27 (81%) Frame = +3 Query: 516 SRITIHWPSFLQRXDWENPGVTQLNRL 596 SRITIHWPSF WENPGVTQLNRL Sbjct: 2 SRITIHWPSFYNVVHWENPGVTQLNRL 28 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 49.2 bits (112), Expect = 2e-06 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = -3 Query: 596 KAIKLGNARVFPVXTL*KRRPVNCNTTH 513 KAIKLGNA VFP + KRRPVNCNTTH Sbjct: 21 KAIKLGNASVFPSHDVVKRRPVNCNTTH 48 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 49.2 bits (112), Expect = 2e-06 Identities = 22/28 (78%), Positives = 23/28 (82%) Frame = -3 Query: 596 KAIKLGNARVFPVXTL*KRRPVNCNTTH 513 KAIKLGNA VFP + KRRPVNCNTTH Sbjct: 35 KAIKLGNASVFPSHDVVKRRPVNCNTTH 62 >SB_14140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 48.4 bits (110), Expect = 4e-06 Identities = 24/45 (53%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGANGGD 395 +I IG + GTGPPLEVDGIDKLDIEF G A G+ Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAATAGE 52 Score = 41.5 bits (93), Expect = 5e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +3 Query: 543 FLQRXDWENPGVTQLNRL 596 FLQR DWENPGVTQLNRL Sbjct: 68 FLQRRDWENPGVTQLNRL 85 >SB_40668| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 47.6 bits (108), Expect = 8e-06 Identities = 24/44 (54%), Positives = 26/44 (59%), Gaps = 1/44 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGANGG 398 +I IG + GTGPPLEVDGIDKLDIEF G A G Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAATAG 51 Score = 35.1 bits (77), Expect = 0.043 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DW+NPGVT LNRL Sbjct: 70 LQRLDWKNPGVTPLNRL 86 >SB_18265| Best HMM Match : BA14K (HMM E-Value=5.9) Length = 163 Score = 47.6 bits (108), Expect = 8e-06 Identities = 24/41 (58%), Positives = 26/41 (63%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G GA Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSARAGA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 47.6 bits (108), Expect = 8e-06 Identities = 21/28 (75%), Positives = 23/28 (82%) Frame = -3 Query: 596 KAIKLGNARVFPVXTL*KRRPVNCNTTH 513 KAIKLGNA+ FP + KRRPVNCNTTH Sbjct: 27 KAIKLGNAKGFPSHDVVKRRPVNCNTTH 54 >SB_1601| Best HMM Match : RuvB_C (HMM E-Value=3.6) Length = 237 Score = 46.8 bits (106), Expect = 1e-05 Identities = 22/28 (78%), Positives = 22/28 (78%) Frame = -3 Query: 596 KAIKLGNARVFPVXTL*KRRPVNCNTTH 513 KAIKLGNAR FP KRRPVNCNTTH Sbjct: 66 KAIKLGNARGFPSHDGEKRRPVNCNTTH 93 Score = 37.9 bits (84), Expect = 0.006 Identities = 16/17 (94%), Positives = 17/17 (100%) Frame = +2 Query: 443 REFDIKLIDTVDLEGGP 493 +EFDIKLIDTVDLEGGP Sbjct: 116 QEFDIKLIDTVDLEGGP 132 >SB_45580| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 46.8 bits (106), Expect = 1e-05 Identities = 23/45 (51%), Positives = 27/45 (60%), Gaps = 1/45 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGANGGD 395 +I IG + G+GPPLEVDGIDKLDIEF G A G+ Sbjct: 8 LISANIGTKAGSGPPLEVDGIDKLDIEFLQPGGSTSSRAAATAGE 52 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_29330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 46.0 bits (104), Expect = 2e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 IISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_11263| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 46.0 bits (104), Expect = 2e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 IISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_51483| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 46.0 bits (104), Expect = 2e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 IISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 46.0 bits (104), Expect = 2e-05 Identities = 21/39 (53%), Positives = 25/39 (64%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPL 482 ARRLSWVTPGFSQS RCK + L + G+ PP+ Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPPPV 65 >SB_51122| Best HMM Match : UCR_TM (HMM E-Value=5.5) Length = 131 Score = 45.6 bits (103), Expect = 3e-05 Identities = 21/34 (61%), Positives = 21/34 (61%) Frame = -1 Query: 499 GTGPPLEVDGIDKLDIEFAAXDGGDQREGGANGG 398 GTGPPLEVDGIDKLDIEF G A G Sbjct: 5 GTGPPLEVDGIDKLDIEFLQPGGSTSSRAAATVG 38 Score = 34.3 bits (75), Expect = 0.076 Identities = 14/19 (73%), Positives = 14/19 (73%) Frame = +3 Query: 489 GPVPNSPIVSRITIHWPSF 545 G P PIVS ITIHWPSF Sbjct: 38 GGAPIRPIVSHITIHWPSF 56 >SB_35726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.6 bits (103), Expect = 3e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFVQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_29104| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.6 bits (103), Expect = 3e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIGEL-GTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTIAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_8453| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.6 bits (103), Expect = 3e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFVEPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 45.6 bits (103), Expect = 3e-05 Identities = 21/28 (75%), Positives = 22/28 (78%) Frame = -3 Query: 596 KAIKLGNARVFPVXTL*KRRPVNCNTTH 513 KAIKLGNA VF + KRRPVNCNTTH Sbjct: 9 KAIKLGNASVFRSHDVVKRRPVNCNTTH 36 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 45.6 bits (103), Expect = 3e-05 Identities = 20/27 (74%), Positives = 21/27 (77%) Frame = +3 Query: 516 SRITIHWPSFLQRXDWENPGVTQLNRL 596 SRITIHWPSF +NPGVTQLNRL Sbjct: 2 SRITIHWPSFYNVVTGKNPGVTQLNRL 28 >SB_1435| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 45.6 bits (103), Expect = 3e-05 Identities = 21/38 (55%), Positives = 24/38 (63%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPP 485 ARRLSWVTPGFSQS RCK + L + G+ PP Sbjct: 8 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPPP 45 >SB_56189| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRLDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_54578| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_53625| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_43970| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_38141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_37635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_33883| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_33319| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_32339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_28717| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_27165| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_26597| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_18695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_12313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_8655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_7630| Best HMM Match : CAT (HMM E-Value=0) Length = 285 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_4868| Best HMM Match : BA14K (HMM E-Value=10) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_3303| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGAKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_1559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRLDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFVDPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_53032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_51836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRPDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_46381| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_45645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_38794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_37358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_32716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRHDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_26542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_24882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_18534| Best HMM Match : BA14K (HMM E-Value=1.5) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_17907| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 >SB_14251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_13915| Best HMM Match : CAT (HMM E-Value=7.9e-08) Length = 215 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_10661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_8727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_7664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 >SB_7106| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 45.2 bits (102), Expect = 4e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_33127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 44.8 bits (101), Expect = 5e-05 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -1 Query: 499 GTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 GTGPPLEVDGIDKLDIEF G A Sbjct: 5 GTGPPLEVDGIDKLDIEFVQPGGSTSSRAAA 35 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 56 LQRRDWENPGVTQLNRL 72 >SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 44.8 bits (101), Expect = 5e-05 Identities = 23/43 (53%), Positives = 27/43 (62%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEVDG 470 ARRLSWVTPGFSQS RCK + L + G+ PL+V G Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS--PLDVSG 67 >SB_35302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.8 bits (101), Expect = 5e-05 Identities = 23/40 (57%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = -1 Query: 523 IRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 9 ISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_34477| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.8 bits (101), Expect = 5e-05 Identities = 23/41 (56%), Positives = 25/41 (60%), Gaps = 1/41 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 +I IG + GTGPPLEVDGIDKLDIEF G A Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGGSTTSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_50195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 44.4 bits (100), Expect = 7e-05 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -1 Query: 499 GTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 GTGPPLEVDGIDKLDIEF G A Sbjct: 48 GTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 78 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 99 LQRRDWENPGVTQLNRL 115 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 84 QFALYESYYNSLAVV 98 >SB_37147| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 44.4 bits (100), Expect = 7e-05 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -1 Query: 499 GTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 GTGPPLEVDGIDKLDIEF G A Sbjct: 20 GTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 50 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 71 LQRRDWENPGVTQLNRL 87 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 56 QFALYESYYNSLAVV 70 >SB_18679| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 44.4 bits (100), Expect = 7e-05 Identities = 22/33 (66%), Positives = 24/33 (72%), Gaps = 1/33 (3%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDG 431 +I IG + GTGPPLEVDGIDKLDIEF G Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDIEFLQPGG 40 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRRDWENPGVTQLNRL 85 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 54 QFALYESYYNSLAVV 68 >SB_26318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 44.4 bits (100), Expect = 7e-05 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -1 Query: 499 GTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 GTGPPLEVDGIDKLDIEF G A Sbjct: 7 GTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 37 >SB_8415| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 44.4 bits (100), Expect = 7e-05 Identities = 20/31 (64%), Positives = 20/31 (64%) Frame = -1 Query: 499 GTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 GTGPPLEVDGIDKLDIEF G A Sbjct: 56 GTGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 86 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 107 LQRRDWENPGVTQLNRL 123 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 92 QFALYESYYNSLAVV 106 >SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) Length = 218 Score = 44.0 bits (99), Expect = 9e-05 Identities = 22/52 (42%), Positives = 30/52 (57%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEVDGIDKLDIEFA 443 ARRLSWVTPGFSQS RCK + L + G+ P + +G + + F+ Sbjct: 49 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPPIRQSNGKRRCFLAFS 100 >SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 44.0 bits (99), Expect = 9e-05 Identities = 23/45 (51%), Positives = 27/45 (60%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEVDGID 464 ARRLSWVTPGFSQS RCK + L + G+ P + GID Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS-PEVSNKGID 70 >SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) Length = 144 Score = 44.0 bits (99), Expect = 9e-05 Identities = 23/41 (56%), Positives = 26/41 (63%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEV 476 ARRLSWVTPGFSQS RCK + L + G+ P LEV Sbjct: 49 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS-PALEV 88 >SB_50545| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 499 GTGPPLEVDGIDKLDIEFAAXDG 431 GTGPPLEVDGIDKLDIEF G Sbjct: 23 GTGPPLEVDGIDKLDIEFLQPGG 45 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/28 (67%), Positives = 22/28 (78%) Frame = -3 Query: 596 KAIKLGNARVFPVXTL*KRRPVNCNTTH 513 K+IKL +A VFP + KRRPVNCNTTH Sbjct: 29 KSIKLAHASVFPSHDVVKRRPVNCNTTH 56 >SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 43.6 bits (98), Expect = 1e-04 Identities = 23/41 (56%), Positives = 26/41 (63%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEV 476 ARRLSWVTPGFSQS RCK + L + G+ PLEV Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS--PLEV 65 >SB_46693| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 43.6 bits (98), Expect = 1e-04 Identities = 19/23 (82%), Positives = 19/23 (82%) Frame = -1 Query: 499 GTGPPLEVDGIDKLDIEFAAXDG 431 GTGPPLEVDGIDKLDIEF G Sbjct: 23 GTGPPLEVDGIDKLDIEFLQPGG 45 >SB_19885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 43.6 bits (98), Expect = 1e-04 Identities = 22/40 (55%), Positives = 25/40 (62%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLE 479 ARRLSWVTPGFSQS RCK + L + G+ PP E Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS-PPAE 65 >SB_12114| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 43.6 bits (98), Expect = 1e-04 Identities = 27/55 (49%), Positives = 30/55 (54%), Gaps = 3/55 (5%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGT---GPPLEVDGIDKLDIEFA 443 ARRLSWVTPGFSQS RCK + L + G+ PLE KL I FA Sbjct: 49 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPRQTQPLEPILFPKLRIYFA 103 >SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/39 (53%), Positives = 24/39 (61%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPL 482 ARRLSWVTPGFSQS RCK + L + G+ PL Sbjct: 49 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPIPL 87 >SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 43.2 bits (97), Expect = 2e-04 Identities = 25/49 (51%), Positives = 30/49 (61%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEVDGIDKLDI 452 ARRLSWVTPGFSQS RCK + L + G+ P+ V +DK DI Sbjct: 49 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS--PVSV--VDKGDI 93 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 43.2 bits (97), Expect = 2e-04 Identities = 20/36 (55%), Positives = 22/36 (61%) Frame = +3 Query: 489 GPVPNSPIVSRITIHWPSFLQRXDWENPGVTQLNRL 596 G P PIVSRITIHWP+F + TQLNRL Sbjct: 36 GGAPIRPIVSRITIHWPAFYNAPTGKTLAYTQLNRL 71 >SB_29177| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 43.2 bits (97), Expect = 2e-04 Identities = 21/42 (50%), Positives = 25/42 (59%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEVD 473 ARRLSWVTPGFSQS RCK + L + G+ +E D Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPRTIESD 68 >SB_8218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 43.2 bits (97), Expect = 2e-04 Identities = 19/31 (61%), Positives = 20/31 (64%) Frame = -1 Query: 499 GTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 GTGPPLE+DGIDKLDIEF G A Sbjct: 5 GTGPPLELDGIDKLDIEFLQPGGSTSSRAAA 35 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 56 LQRRDWENPGVTQLNRL 72 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 41 QFALYESYYNSLAVV 55 >SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/37 (54%), Positives = 23/37 (62%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGP 488 ARRLSWVTPGFSQS RCK + L + G+ P Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPP 63 >SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) Length = 297 Score = 42.7 bits (96), Expect = 2e-04 Identities = 22/45 (48%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTG-PPLEVDGI 467 ARRLSWVTPGFSQS RCK + L + G+ P DG+ Sbjct: 49 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPFPGARYDGV 93 >SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) Length = 1232 Score = 42.7 bits (96), Expect = 2e-04 Identities = 23/49 (46%), Positives = 29/49 (59%), Gaps = 1/49 (2%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGT-GPPLEVDGIDKLD 455 ARRLSWVTPGFSQS RCK + L + G+ P ++V G+ D Sbjct: 1131 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPKPAVKVFGLSWSD 1179 >SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/37 (54%), Positives = 23/37 (62%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGP 488 ARRLSWVTPGFSQS RCK + L + G+ P Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPP 63 >SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 194 Score = 42.7 bits (96), Expect = 2e-04 Identities = 29/72 (40%), Positives = 36/72 (50%), Gaps = 17/72 (23%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDG-----------GDQ-----REGGANGG 398 +I IG + GTGPPLEVDGIDKLD++ + D G Q EG N G Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDVDSDSVDSDSVDSDSVERLGVQVTKQGNEGNTNRG 67 Query: 397 DGNCSNCQKGSP 362 G ++C G P Sbjct: 68 KGGSNSCSPGDP 79 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 107 LQRRDWENPGVTQLNRL 123 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 509 YSESYYNSLAVV 544 YSESYYNSLAVV Sbjct: 95 YSESYYNSLAVV 106 >SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 42.7 bits (96), Expect = 2e-04 Identities = 28/77 (36%), Positives = 36/77 (46%), Gaps = 2/77 (2%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEVD-GIDKLDIEFAAXDGGDQ 422 ARRLSWVTPGFSQS RCK + L + G+ P LE + +F G + Sbjct: 49 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS-PSLERGAAVQARQFDFRPHAGEAR 107 Query: 421 -REGGANGGDGNCSNCQ 374 GG+ G + Q Sbjct: 108 INSGGSRRDQGRTGDAQ 124 >SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/37 (54%), Positives = 23/37 (62%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGP 488 ARRLSWVTPGFSQS RCK + L + G+ P Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPP 63 >SB_11228| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 42.7 bits (96), Expect = 2e-04 Identities = 20/37 (54%), Positives = 23/37 (62%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGP 488 ARRLSWVTPGFSQS RCK + L + G+ P Sbjct: 20 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPP 56 >SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/43 (51%), Positives = 26/43 (60%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEVDG 470 ARRLSWVTPGFSQS RCK + L + G+ P +V G Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS-PDEQVQG 68 >SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) Length = 220 Score = 42.3 bits (95), Expect = 3e-04 Identities = 21/41 (51%), Positives = 24/41 (58%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEV 476 ARRLSWVTPGFSQS RCK + L + G+ P V Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPYPAAV 67 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 42.3 bits (95), Expect = 3e-04 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +3 Query: 516 SRITIHWPSFLQRXDWENPGVTQLNRL 596 SRITIHWPSF +N GVTQLNRL Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRL 28 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 42.3 bits (95), Expect = 3e-04 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +3 Query: 516 SRITIHWPSFLQRXDWENPGVTQLNRL 596 SRITIHWPSF +N GVTQLNRL Sbjct: 2 SRITIHWPSFYNVVTGKNTGVTQLNRL 28 >SB_1099| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 42.3 bits (95), Expect = 3e-04 Identities = 22/47 (46%), Positives = 28/47 (59%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEVDGIDKL 458 ARRLSWVTPGFSQS RCK + L + G+ P + I++L Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS-PGTVISDINRL 72 >SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 41.9 bits (94), Expect = 4e-04 Identities = 21/42 (50%), Positives = 25/42 (59%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEVD 473 ARRLSWVTPGFSQS RCK + L + G+ P +D Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS--PFNID 66 >SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/38 (52%), Positives = 23/38 (60%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPP 485 ARRLSWVTPGFSQS RCK + L + G+ P Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPMP 64 >SB_13218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 41.9 bits (94), Expect = 4e-04 Identities = 19/31 (61%), Positives = 19/31 (61%) Frame = -1 Query: 499 GTGPPLEVDGIDKLDIEFAAXDGGDQREGGA 407 G GPPLEVDGIDKLDIEF G A Sbjct: 18 GPGPPLEVDGIDKLDIEFLQPGGSTSSRAAA 48 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 69 LQRPDWENPGVTQLNRL 85 >SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) Length = 137 Score = 41.9 bits (94), Expect = 4e-04 Identities = 21/47 (44%), Positives = 27/47 (57%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEVDGIDKL 458 ARRLSWVTPGFSQS RCK + L + G+ L++ + L Sbjct: 49 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPLLLDIGDLRSL 95 >SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) Length = 283 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/38 (52%), Positives = 23/38 (60%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPP 485 ARRLSWVTPGFSQS RCK + L + G+ P Sbjct: 125 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPGP 162 >SB_49537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 41.9 bits (94), Expect = 4e-04 Identities = 20/37 (54%), Positives = 25/37 (67%), Gaps = 1/37 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGGDQR 419 +I IG + GTGPPLEVDGIDKLD+ + GD + Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDVHHIWKEPGDSK 44 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 108 LQRRDWENPGVTQLNRL 124 Score = 28.7 bits (61), Expect = 3.8 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = +2 Query: 500 QFAYSESYYNSLAVV 544 QFA ESYYNSLAVV Sbjct: 93 QFALYESYYNSLAVV 107 >SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) Length = 271 Score = 41.9 bits (94), Expect = 4e-04 Identities = 22/47 (46%), Positives = 26/47 (55%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEVDGIDKL 458 ARRLSWVTPGFSQS RCK + L + G+ L + D L Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSLSCLRIMHADSL 73 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/41 (51%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = +3 Query: 483 RGGPVPNSPIVS---RITIHWPSFLQRXDWENPGVTQLNRL 596 +GG V P+ S ++ LQR DWENPGVTQLNRL Sbjct: 11 KGGQVSGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRL 51 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/41 (51%), Positives = 25/41 (60%), Gaps = 3/41 (7%) Frame = +3 Query: 483 RGGPVPNSPIVS---RITIHWPSFLQRXDWENPGVTQLNRL 596 +GG V P+ S ++ LQR DWENPGVTQLNRL Sbjct: 11 KGGQVSGDPLESTCRHASLALAVVLQRRDWENPGVTQLNRL 51 >SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) Length = 240 Score = 41.5 bits (93), Expect = 5e-04 Identities = 20/38 (52%), Positives = 23/38 (60%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPP 485 ARRLSWVTPGFSQS RCK + L + G+ P Sbjct: 49 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPCP 86 >SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) Length = 631 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/31 (61%), Positives = 21/31 (67%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIG 506 ARRLSWVTPGFSQS RCK + L +G Sbjct: 476 ARRLSWVTPGFSQSRRCKTTASAKLACLQVG 506 >SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 41.5 bits (93), Expect = 5e-04 Identities = 20/42 (47%), Positives = 25/42 (59%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEVD 473 ARRLSWVTPGFSQS RCK + L + G+ + +D Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPSLIIID 68 >SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/41 (51%), Positives = 26/41 (63%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEV 476 ARRLSWVTPGFSQS RCK + L + G+ P++V Sbjct: 49 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS--PIDV 87 >SB_55259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 41.5 bits (93), Expect = 5e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = +3 Query: 543 FLQRXDWENPGVTQLNRL 596 FLQR DWENPGVTQLNRL Sbjct: 11 FLQRRDWENPGVTQLNRL 28 >SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) Length = 1814 Score = 41.5 bits (93), Expect = 5e-04 Identities = 22/42 (52%), Positives = 25/42 (59%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEVD 473 ARRLSWVTPGFSQS RCK + L + G+ P VD Sbjct: 719 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS--PRNVD 758 >SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 41.5 bits (93), Expect = 5e-04 Identities = 22/45 (48%), Positives = 26/45 (57%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEVDGID 464 ARRLSWVTPGFSQS RCK + L + G+ L+ ID Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGSPCNLQKVTID 71 >SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/33 (57%), Positives = 24/33 (72%), Gaps = 3/33 (9%) Frame = +3 Query: 507 PIVSRITIHWPSF---LQRXDWENPGVTQLNRL 596 P++ R+ ++ S LQR DWENPGVTQLNRL Sbjct: 50 PVMGRLESYYNSLAVVLQRRDWENPGVTQLNRL 82 Score = 37.5 bits (83), Expect = 0.008 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 1/25 (4%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLD 455 +I IG + GTGPPLEVDGIDKLD Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLD 32 >SB_17640| Best HMM Match : DUF329 (HMM E-Value=6.7) Length = 221 Score = 41.5 bits (93), Expect = 5e-04 Identities = 21/33 (63%), Positives = 23/33 (69%), Gaps = 1/33 (3%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDG 431 +I IG + GTGPPLEVDGIDKLD E DG Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDPELHPADG 40 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 134 LQRRDWENPGVTQLNRL 150 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 509 YSESYYNSLAVV 544 YSESYYNSLAVV Sbjct: 122 YSESYYNSLAVV 133 >SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 41.5 bits (93), Expect = 5e-04 Identities = 19/27 (70%), Positives = 20/27 (74%) Frame = +3 Query: 516 SRITIHWPSFLQRXDWENPGVTQLNRL 596 SRITIHWPSF + PGVTQLNRL Sbjct: 2 SRITIHWPSFYNVMLAKTPGVTQLNRL 28 >SB_6665| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 41.5 bits (93), Expect = 5e-04 Identities = 22/50 (44%), Positives = 28/50 (56%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCKNDGQ*IVIRLTIGELGTGPPLEVDGIDKLDIE 449 ARRLSWVTPGFSQS RCK + L + G+ P+ V K ++ Sbjct: 27 ARRLSWVTPGFSQSRRCKTTASAKLACLQVDSRGS--PINVKQFAKFVVD 74 >SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3213 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 502 ARRLSWVTPGFSQSRRCK 519 >SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) Length = 123 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 49 ARRLSWVTPGFSQSRRCK 66 >SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) Length = 212 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 172 ARRLSWVTPGFSQSRRCK 189 >SB_58792| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 34 ARRLSWVTPGFSQSRRCK 51 >SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 55 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 328 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 249 ARRLSWVTPGFSQSRRCK 266 >SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 393 ARRLSWVTPGFSQSRRCK 410 >SB_55579| Best HMM Match : Rhodanese (HMM E-Value=9.2e-29) Length = 269 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 246 ARRLSWVTPGFSQSRRCK 263 >SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) Length = 141 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 49 ARRLSWVTPGFSQSRRCK 66 >SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) Length = 533 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 95 ARRLSWVTPGFSQSRRCK 112 >SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) Length = 185 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 49 ARRLSWVTPGFSQSRRCK 66 >SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) Length = 1127 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 676 ARRLSWVTPGFSQSRRCK 693 >SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 473 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_50054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 914 ARRLSWVTPGFSQSRRCK 931 >SB_49806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 829 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 182 ARRLSWVTPGFSQSRRCK 199 >SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_47433| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 26 ARRLSWVTPGFSQSRRCK 43 >SB_47291| Best HMM Match : PilN (HMM E-Value=0.75) Length = 424 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 401 ARRLSWVTPGFSQSRRCK 418 >SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) Length = 388 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) Length = 305 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_45437| Best HMM Match : Ribosomal_L15e (HMM E-Value=0.53) Length = 273 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 250 ARRLSWVTPGFSQSRRCK 267 >SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 41.1 bits (92), Expect = 7e-04 Identities = 21/34 (61%), Positives = 23/34 (67%), Gaps = 1/34 (2%) Frame = -1 Query: 526 VIRLTIG-ELGTGPPLEVDGIDKLDIEFAAXDGG 428 +I IG + GTGPPLEVDGIDKLD A GG Sbjct: 8 LISANIGTKAGTGPPLEVDGIDKLDDRLDASGGG 41 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 130 LQRRDWENPGVTQLNRL 146 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 509 YSESYYNSLAVV 544 YSESYYNSLAVV Sbjct: 118 YSESYYNSLAVV 129 >SB_42949| Best HMM Match : SRCR (HMM E-Value=1.6e-14) Length = 340 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 317 ARRLSWVTPGFSQSRRCK 334 >SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) Length = 154 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 49 ARRLSWVTPGFSQSRRCK 66 >SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) Length = 735 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 585 ARRLSWVTPGFSQSRRCK 602 >SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) Length = 666 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 432 ARRLSWVTPGFSQSRRCK 449 >SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_40068| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 406 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 383 ARRLSWVTPGFSQSRRCK 400 >SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) Length = 128 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) Length = 794 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 49 ARRLSWVTPGFSQSRRCK 66 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 209 ARRLSWVTPGFSQSRRCK 226 Score = 35.9 bits (79), Expect = 0.025 Identities = 15/17 (88%), Positives = 15/17 (88%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWEN GVTQLNRL Sbjct: 519 LQRRDWENTGVTQLNRL 535 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 509 YSESYYNSLAVV 544 YSESYYNSLAVV Sbjct: 507 YSESYYNSLAVV 518 >SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 49 ARRLSWVTPGFSQSRRCK 66 >SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 59 ARRLSWVTPGFSQSRRCK 76 >SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1081 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 815 ARRLSWVTPGFSQSRRCK 832 >SB_36207| Best HMM Match : 7kD_coat (HMM E-Value=7.6) Length = 98 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 75 ARRLSWVTPGFSQSRRCK 92 >SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) Length = 143 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 49 ARRLSWVTPGFSQSRRCK 66 >SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 95 ARRLSWVTPGFSQSRRCK 112 >SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 49 ARRLSWVTPGFSQSRRCK 66 >SB_31511| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 372 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 34 ARRLSWVTPGFSQSRRCK 51 >SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 41 ARRLSWVTPGFSQSRRCK 58 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 34 ARRLSWVTPGFSQSRRCK 51 Score = 39.1 bits (87), Expect = 0.003 Identities = 16/17 (94%), Positives = 16/17 (94%) Frame = +3 Query: 546 LQRXDWENPGVTQLNRL 596 LQR DWENPGVTQLNRL Sbjct: 89 LQRRDWENPGVTQLNRL 105 Score = 28.3 bits (60), Expect = 5.0 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +2 Query: 509 YSESYYNSLAVV 544 YSESYYNSLAVV Sbjct: 77 YSESYYNSLAVV 88 >SB_29477| Best HMM Match : Antistasin (HMM E-Value=9.2) Length = 73 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 68 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) Length = 214 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_28196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_27897| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 534 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 397 ARRLSWVTPGFSQSRRCK 414 >SB_27010| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_26995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 34 ARRLSWVTPGFSQSRRCK 51 >SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) Length = 412 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 322 ARRLSWVTPGFSQSRRCK 339 >SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1758 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 136 ARRLSWVTPGFSQSRRCK 153 >SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 46 ARRLSWVTPGFSQSRRCK 63 >SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 46 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 8 ARRLSWVTPGFSQSRRCK 25 >SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 20 ARRLSWVTPGFSQSRRCK 37 >SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) Length = 466 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) Length = 322 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 49 ARRLSWVTPGFSQSRRCK 66 >SB_20900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 57 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 34 ARRLSWVTPGFSQSRRCK 51 >SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 49 ARRLSWVTPGFSQSRRCK 66 >SB_20814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 57 ARRLSWVTPGFSQSRRCK 74 >SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) Length = 230 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 62 ARRLSWVTPGFSQSRRCK 79 >SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 80 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 49 ARRLSWVTPGFSQSRRCK 66 >SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 78 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 41 ARRLSWVTPGFSQSRRCK 58 >SB_15447| Best HMM Match : C1_1 (HMM E-Value=0.11) Length = 316 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 293 ARRLSWVTPGFSQSRRCK 310 >SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) Length = 742 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 512 ARRLSWVTPGFSQSRRCK 529 >SB_14175| Best HMM Match : GBP_repeat (HMM E-Value=3.8) Length = 300 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 277 ARRLSWVTPGFSQSRRCK 294 >SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) Length = 184 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 83 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 66 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 120 ARRLSWVTPGFSQSRRCK 137 >SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 80 ARRLSWVTPGFSQSRRCK 97 >SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 70 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_8424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 82 ARRLSWVTPGFSQSRRCK 99 >SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 67 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_6796| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 925 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 556 ARRLSWVTPGFSQSRRCK 573 >SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 76 ARRLSWVTPGFSQSRRCK 93 >SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) Length = 90 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_5984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 374 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) Length = 542 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 181 ARRLSWVTPGFSQSRRCK 198 >SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) Length = 546 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 49 ARRLSWVTPGFSQSRRCK 66 >SB_2952| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 49 ARRLSWVTPGFSQSRRCK 66 >SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 65 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) Length = 338 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 49 ARRLSWVTPGFSQSRRCK 66 >SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 27 ARRLSWVTPGFSQSRRCK 44 >SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) Length = 427 Score = 41.1 bits (92), Expect = 7e-04 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -1 Query: 598 ARRLSWVTPGFSQSXRCK 545 ARRLSWVTPGFSQS RCK Sbjct: 49 ARRLSWVTPGFSQSRRCK 66 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,240,488 Number of Sequences: 59808 Number of extensions: 244685 Number of successful extensions: 6236 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3735 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6218 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1439498375 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -