BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= msgV0112.Seq (598 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q380W9 Cluster: Putative uncharacterized protein; n=1; ... 29 0.56 UniRef50_Q4P652 Cluster: Pre-mRNA-splicing factor CEF1; n=1; Ust... 32 8.9 >UniRef50_Q380W9 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 232 Score = 29.5 bits (63), Expect(2) = 0.56 Identities = 12/33 (36%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +3 Query: 474 CDCSLLEIA-FALSFVQFYCYD*NGHHYYCSYY 569 C CS I + L+ + ++ Y + ++YYCSYY Sbjct: 120 CYCSYYNIRIYTLTTLSYHYYYHHHYYYYCSYY 152 Score = 25.8 bits (54), Expect(2) = 0.56 Identities = 8/11 (72%), Positives = 9/11 (81%) Frame = +3 Query: 546 HHYYCSYYLSH 578 H+YYCSYY H Sbjct: 171 HYYYCSYYNIH 181 >UniRef50_Q4P652 Cluster: Pre-mRNA-splicing factor CEF1; n=1; Ustilago maydis|Rep: Pre-mRNA-splicing factor CEF1 - Ustilago maydis (Smut fungus) Length = 820 Score = 32.3 bits (70), Expect = 8.9 Identities = 21/60 (35%), Positives = 33/60 (55%), Gaps = 1/60 (1%) Frame = -2 Query: 510 RAQKQFQAVNSHRISQAVHRNLPRPL-MDLKAPSQQVNTRAANQRPVAVLALRVPVKVLH 334 R + +A + R SQ V RNLPRP +DL Q+++R ++ V +L R ++LH Sbjct: 541 RQAAEEEARSEARRSQVVRRNLPRPAQVDLSRLHNQIDSRYRDR--VELLVARETAQLLH 598 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 433,584,471 Number of Sequences: 1657284 Number of extensions: 7198977 Number of successful extensions: 16163 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 15363 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16042 length of database: 575,637,011 effective HSP length: 97 effective length of database: 414,880,463 effective search space used: 41902926763 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -